Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human AFF4 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UHB7
Molecular weight:
29.78 kDa

Original price was: €235.00.Current price is: €193.00.

50ug 18% OFF + 193 loyalty points
Ser914–Lys1160
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human AFF4 Protein, N-His

Product name ARO-P11596-100
Uniprot ID Q9UHB7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SADHYLQEAKKLKHNADALSDRFEKAVYYLDAVVSFIECGNALEKNAQESKSPFPMYSETVDLIKYTMKLKNYLAPDATAADKRLTVLCLRCESLLYLRLFKLKKENALKYSKTLTEHLKNSYNNSQAPSPGLGSKAVGMPSPVSPKLSPGNSGNYSSGASSASASGSSVTIPQKIHQMAASYVQVTSNFLYATEIWDQAEQLSKEQKEFFAELDKVMGPLIFNASIMTDLVRYTRQGLHWLRQDAK
Molecular weight 29.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser914-Lys1160
Aliases /Synonyms Major CDK9 elongation factor-associated protein, MCEF, Protein AF-5q31, ALL1-fused gene from chromosome 5q31 protein, AF5Q31, AFF4, AF4/FMR2 family member 4
Reference ARO-P11596
Note For research use only.
Molecular Constructor
Ser914–Lys1160
Product name ARO-P11596-1MG
Uniprot ID Q9UHB7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SADHYLQEAKKLKHNADALSDRFEKAVYYLDAVVSFIECGNALEKNAQESKSPFPMYSETVDLIKYTMKLKNYLAPDATAADKRLTVLCLRCESLLYLRLFKLKKENALKYSKTLTEHLKNSYNNSQAPSPGLGSKAVGMPSPVSPKLSPGNSGNYSSGASSASASGSSVTIPQKIHQMAASYVQVTSNFLYATEIWDQAEQLSKEQKEFFAELDKVMGPLIFNASIMTDLVRYTRQGLHWLRQDAK
Molecular weight 29.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser914-Lys1160
Aliases /Synonyms Major CDK9 elongation factor-associated protein, MCEF, Protein AF-5q31, ALL1-fused gene from chromosome 5q31 protein, AF5Q31, AFF4, AF4/FMR2 family member 4
Reference ARO-P11596
Note For research use only.
Molecular Constructor
Ser914–Lys1160
Product name ARO-P11596-50
Uniprot ID Q9UHB7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SADHYLQEAKKLKHNADALSDRFEKAVYYLDAVVSFIECGNALEKNAQESKSPFPMYSETVDLIKYTMKLKNYLAPDATAADKRLTVLCLRCESLLYLRLFKLKKENALKYSKTLTEHLKNSYNNSQAPSPGLGSKAVGMPSPVSPKLSPGNSGNYSSGASSASASGSSVTIPQKIHQMAASYVQVTSNFLYATEIWDQAEQLSKEQKEFFAELDKVMGPLIFNASIMTDLVRYTRQGLHWLRQDAK
Molecular weight 29.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser914-Lys1160
Aliases /Synonyms Major CDK9 elongation factor-associated protein, MCEF, Protein AF-5q31, ALL1-fused gene from chromosome 5q31 protein, AF5Q31, AFF4, AF4/FMR2 family member 4
Reference ARO-P11596
Note For research use only.
Molecular Constructor
Ser914–Lys1160

Introduction

Recombinant Human AFF4 Protein, also known as AF4/FMR2 family member 4, is a protein that plays a crucial role in transcriptional regulation and chromatin remodeling. It is encoded by the AFF4 gene located on chromosome 5 in humans. This protein has been extensively studied due to its involvement in various cellular processes and its potential as a therapeutic target. In this article, we will delve into the structure, activity, and applications of Recombinant Human AFF4 Protein.

Structure of Recombinant Human AFF4 Protein

Recombinant Human AFF4 Protein is a 170 kDa protein composed of 1532 amino acids. It belongs to the AF4/FMR2 family of proteins and contains conserved domains such as the AF4/FMR2 family conserved region (AFCR) and the serine-rich domain (SRD). The AFCR domain is essential for protein-protein interactions, while the SRD is involved in transcriptional activation. The protein also contains multiple phosphorylation sites, indicating its regulation through post-translational modifications.

Activity of Recombinant Human AFF4 Protein

Recombinant Human AFF4 Protein is a key component of the super elongation complex (SEC), which is responsible for regulating transcription elongation. It interacts with other proteins such as ELL, ELL2, and P-TEFb to form the SEC, which is recruited to the promoter regions of actively transcribed genes. This complex then facilitates the release of paused RNA polymerase II, enabling efficient transcription elongation.

Apart from its role in transcriptional regulation, Recombinant Human AFF4 Protein has also been shown to play a crucial role in chromatin remodeling. It interacts with the histone acetyltransferase p300 and the chromatin remodeling factor BRD4 to promote histone acetylation and chromatin decompaction. This activity is important for proper gene expression and cellular differentiation.

Applications of Recombinant Human AFF4 Protein

The unique structure and activity of Recombinant Human AFF4 Protein make it a valuable tool for various research applications. One of its primary uses is in studying transcriptional regulation and chromatin remodeling. Recombinant Human AFF4 Protein can be used in in vitro assays to characterize its interactions with other proteins and its role in transcriptional regulation.

Furthermore, the dysregulation of Recombinant Human AFF4 Protein has been linked to various diseases, including cancer and neurodevelopmental disorders. Thus, it has the potential to be a therapeutic target for these conditions. Recombinant Human AFF4 Protein can also be used in drug discovery and development to screen for compounds that can modulate its activity and potentially treat these diseases.

In addition, Recombinant Human AFF4 Protein has been shown to be a potential biomarker for certain cancers, such as acute lymphoblastic leukemia and breast cancer. Its expression levels in patient samples can provide valuable diagnostic and prognostic information, making it a promising biomarker for these diseases.

Conclusion

In summary, Recombinant Human AFF4 Protein is a multifunctional protein involved in transcriptional regulation and chromatin remodeling. Its unique structure and activity make it a valuable tool for studying these processes and its potential as a therapeutic target. With ongoing research, the full extent of its role in cellular processes and its potential applications will continue to be uncovered.

Recombinant Human AFF4 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human AFF4 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products