Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human AFAP1L2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8N4X5
Molecular weight:
17.30 kDa

Original price was: €214.00.Current price is: €193.00.

50ug 10% OFF + 193 loyalty points
Glu355–Glu485
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human AFAP1L2 Protein, N-His

Product name ARO-P11174-100
Uniprot ID Q8N4X5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ETSSYLNVLVNSQWKSRWCSVRDNHLHFYQDRNRSKVAQQPLSLVGCEVVPDPSPDHLYSFRILHKGEELAKLEAKSSEEMGHWLGLLLSESGSKTDPEEFTYDYVDADRVSCIVSAAKNSLLLMQRKFSE
Molecular weight 17.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu355-Glu485
Aliases /Synonyms KIAA1914, AFAP1-like protein 2, Actin filament-associated protein 1-like 2, AFAP1L2, XB130
Reference ARO-P11174
Note For research use only.
Molecular Constructor
Glu355–Glu485
Product name ARO-P11174-1MG
Uniprot ID Q8N4X5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ETSSYLNVLVNSQWKSRWCSVRDNHLHFYQDRNRSKVAQQPLSLVGCEVVPDPSPDHLYSFRILHKGEELAKLEAKSSEEMGHWLGLLLSESGSKTDPEEFTYDYVDADRVSCIVSAAKNSLLLMQRKFSE
Molecular weight 17.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu355-Glu485
Aliases /Synonyms KIAA1914, AFAP1-like protein 2, Actin filament-associated protein 1-like 2, AFAP1L2, XB130
Reference ARO-P11174
Note For research use only.
Molecular Constructor
Glu355–Glu485
Product name ARO-P11174-50
Uniprot ID Q8N4X5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ETSSYLNVLVNSQWKSRWCSVRDNHLHFYQDRNRSKVAQQPLSLVGCEVVPDPSPDHLYSFRILHKGEELAKLEAKSSEEMGHWLGLLLSESGSKTDPEEFTYDYVDADRVSCIVSAAKNSLLLMQRKFSE
Molecular weight 17.30 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu355-Glu485
Aliases /Synonyms KIAA1914, AFAP1-like protein 2, Actin filament-associated protein 1-like 2, AFAP1L2, XB130
Reference ARO-P11174
Note For research use only.
Molecular Constructor
Glu355–Glu485

Introduction

Recombinant Human AFAP1L2 Protein (rhAFAP1L2) is a human protein that has been produced using recombinant DNA technology. It is a member of the actin filament-associated protein 1-like 2 (AFAP1L2) family and plays a crucial role in regulating actin dynamics in cells. In this article, we will discuss the structure, activity, and applications of rhAFAP1L2 protein.

Structure of rhAFAP1L2 protein

The gene encoding for AFAP1L2 protein is located on chromosome 1 in humans. The protein is composed of 636 amino acids and has a molecular weight of approximately 71 kDa. It contains several functional domains, including an N-terminal AFAP1 domain, a central proline-rich region, and a C-terminal SH3 domain. The N-terminal AFAP1 domain is responsible for binding to actin filaments, while the SH3 domain is involved in protein-protein interactions.

Activity of rhAFAP1L2 protein

The main function of AFAP1L2 protein is to regulate the dynamics of actin filaments in cells. Actin filaments are essential components of the cytoskeleton and play a crucial role in cell movement, division, and shape. The AFAP1L2 protein binds to actin filaments and regulates their assembly and disassembly, thereby maintaining the stability of the cytoskeleton. It also interacts with other proteins involved in actin dynamics, such as cofilin and Arp2/3 complex, to modulate their activities.

Studies have shown that AFAP1L2 protein is highly expressed in various tissues, including the brain, heart, and skeletal muscle. It is also found in high levels in cancer cells, where it has been implicated in promoting cell migration and invasion. Additionally, AFAP1L2 has been shown to play a role in neuronal development and synaptic plasticity, making it an important protein in the central nervous system.

Applications of rhAFAP1L2 protein

The recombinant form of AFAP1L2 protein, rhAFAP1L2, has been widely used in various research studies and has potential applications in biotechnology and medicine. One of the main applications of rhAFAP1L2 is in the study of actin dynamics and cytoskeleton regulation. By using rhAFAP1L2, researchers can investigate the role of this protein in various cellular processes and diseases.

Moreover, rhAFAP1L2 has been used as an antigen in the development of diagnostic tests for certain diseases. For example, it has been used as a biomarker for prostate cancer, as its expression is significantly increased in prostate cancer cells. Additionally, rhAFAP1L2 has been identified as a potential therapeutic target for cancer treatment, and research is ongoing to develop drugs that can inhibit its activity.

Furthermore, rhAFAP1L2 has been used in the production of monoclonal antibodies for targeted drug delivery. By conjugating rhAFAP1L2 to a drug or nanoparticle, it can specifically target cancer cells that overexpress AFAP1L2, thereby increasing the efficacy and reducing the side effects of the treatment.

Conclusion

In summary, Recombinant Human AFAP1L2 Protein is a crucial protein involved in regulating actin dynamics in cells. Its structure, activity, and potential applications make it an important protein in both basic research and clinical settings. With ongoing research, rhAFAP1L2 has the potential to be used in various diagnostic and therapeutic applications, making it a valuable tool in the field of biotechnology and medicine.

Recombinant Human AFAP1L2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human AFAP1L2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products