Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Escherichia coli eltB/ltpB Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Escherichia coli
Uniprot ID:
P0CK94
Molecular weight:
24.04 kDa

Original price was: €292.00.Current price is: €230.00.

50ug 21% OFF + 230 loyalty points
Ala22–Asn124
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Escherichia coli eltB/ltpB Protein, N-His-SUMO

Product name ARO-P11534-100
Uniprot ID P0CK94
Origin species Escherichia coli
Expression system Prokaryotic expression
Raw Antigen Sequence APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEN
Molecular weight 24.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala22-Asn124
Aliases /Synonyms Heat-labile enterotoxin B chain, LT-B, human, LTH-B, eltB, ltpB
Reference ARO-P11534
Note For research use only.
Molecular Constructor
Ala22–Asn124
Product name ARO-P11534-1MG
Uniprot ID P0CK94
Origin species Escherichia coli
Expression system Prokaryotic expression
Raw Antigen Sequence APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEN
Molecular weight 24.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala22-Asn124
Aliases /Synonyms Heat-labile enterotoxin B chain, LT-B, human, LTH-B, eltB, ltpB
Reference ARO-P11534
Note For research use only.
Molecular Constructor
Ala22–Asn124
Product name ARO-P11534-50
Uniprot ID P0CK94
Origin species Escherichia coli
Expression system Prokaryotic expression
Raw Antigen Sequence APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEN
Molecular weight 24.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala22-Asn124
Aliases /Synonyms Heat-labile enterotoxin B chain, LT-B, human, LTH-B, eltB, ltpB
Reference ARO-P11534
Note For research use only.
Molecular Constructor
Ala22–Asn124

Introduction to Recombinant Escherichia coli eltB/ltpB Protein

Recombinant proteins are proteins that are produced through genetic engineering techniques, where the DNA sequence of the desired protein is inserted into a host organism for expression. One such recombinant protein is the Escherichia coli eltB/ltpB protein, which has gained significant attention in the field of biotechnology due to its potential applications in various industries.

Structure of Recombinant Escherichia coli eltB/ltpB Protein

The eltB/ltpB protein is a fusion protein consisting of two subunits, eltB and ltpB, derived from the heat-labile enterotoxin of E. coli. The eltB subunit is responsible for binding to the host cell receptor, while the ltpB subunit is involved in the translocation of the toxin into the host cell. The two subunits are joined by a linker sequence, which allows for the proper folding and stability of the protein.

The primary structure of eltB/ltpB protein is composed of 182 amino acids, with a molecular weight of approximately 20 kDa. The protein has a hydrophobic signal sequence, which is removed during the secretion process, and a cysteine residue at the C-terminus, which is important for the stability of the protein.

The tertiary structure of the protein is characterized by a compact globular conformation, with the eltB and ltpB subunits forming a heterodimer through hydrophobic interactions. The protein also contains several disulfide bonds, which contribute to its stability and function.

Activity of Recombinant Escherichia coli eltB/ltpB Protein

The eltB/ltpB protein has been extensively studied for its activity as an antigen, specifically as a mucosal adjuvant. Adjuvants are substances that enhance the immune response to an antigen, making them an essential component of many vaccines. The eltB/ltpB protein has been shown to have potent mucosal adjuvant activity, making it a promising candidate for use in vaccine development.

The protein works by binding to the host cell receptor, which triggers the activation of intracellular signaling pathways that lead to the production of cytokines and chemokines. These immune mediators then recruit and activate immune cells, such as dendritic cells and T cells, to the site of antigen exposure. This results in a robust and long-lasting immune response, making the eltB/ltpB protein an effective adjuvant.

Applications of Recombinant Escherichia coli eltB/ltpB Protein

As mentioned earlier, the eltB/ltpB protein has potential applications in various industries, including vaccine development, biotechnology, and food safety. Its mucosal adjuvant activity makes it a promising candidate for use in mucosal vaccines, particularly for diseases that require a strong mucosal immune response, such as cholera and influenza.

In addition, the protein has been used in biotechnology for the production of recombinant proteins. The eltB/ltpB fusion protein can be used as a carrier protein to increase the immunogenicity of other antigens, making it a valuable tool in protein expression and purification techniques.

Furthermore, the protein has been studied for its potential use in food safety. The eltB/ltpB fusion protein has been shown to bind to the surface of various foodborne pathogens, such as E. coli, Salmonella, and Listeria, and prevent their attachment to host cells. This could potentially be used as a food additive to reduce the risk of foodborne illnesses.

Conclusion

In summary, the Recombinant Escherichia coli eltB/ltpB protein is a fusion protein with two subunits derived from the heat-labile enterotoxin of E. coli. Its compact globular structure and potent mucosal adjuvant activity make

Recombinant Escherichia coli eltB/ltpB Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Escherichia coli eltB/ltpB Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products