Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

E. coli ArsR Nter FLAG and Cter His Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
E. coli
Molecular weight:
15,33 kDa

Original price was: €258.00.Current price is: €210.00.

50ug 19% OFF + 210 loyalty points
Partial Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

E. coli ArsR Nter FLAG and Cter His Recombinant Protein

Product name E. coli ArsR Nter FLAG and Cter His Recombinant Protein
Origin species E. coli
Expression system Prokaryotic expression
Raw Antigen Sequence MDYKDDDDKGSFLLPIQLFKILADETRLGIVLLLSELGELCVCDLCTALDQSQPKISRHLALLRESGLLLDRKQGKWVHY RLSPHIPAWAAKIIDEAWRCEQEKVQAIVRNLARQNCSGDSKNICSLEHHHHHH
Molecular weight 15,33 kDa
Protein delivered with Tag? Yes
Purity estimated 80% (DENATURED)
Buffer PBS, 300mM in native conditions. PBS, Urea 8M, imidazole 10mM in denaturing conditions
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession ZP_03049476.1
NCBI Reference ZP_03049476.1
Aliases /Synonyms ArsR E coli optimized, arsenical resistance operon repressor
Reference PX-P1071
Note For research use only
Molecular Constructor
Partial Yes
Product name E. coli ArsR Nter FLAG and Cter His Recombinant Protein
Origin species E. coli
Expression system Prokaryotic expression
Raw Antigen Sequence MDYKDDDDKGSFLLPIQLFKILADETRLGIVLLLSELGELCVCDLCTALDQSQPKISRHLALLRESGLLLDRKQGKWVHY RLSPHIPAWAAKIIDEAWRCEQEKVQAIVRNLARQNCSGDSKNICSLEHHHHHH
Molecular weight 15,33 kDa
Protein delivered with Tag? Yes
Purity estimated 80% (DENATURED)
Buffer PBS, 300mM in native conditions. PBS, Urea 8M, imidazole 10mM in denaturing conditions
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession ZP_03049476.1
NCBI Reference ZP_03049476.1
Aliases /Synonyms ArsR E coli optimized, arsenical resistance operon repressor
Reference PX-P1071
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P1071-1MG
Origin species E. coli
Expression system Prokaryotic expression
Raw Antigen Sequence MDYKDDDDKGSFLLPIQLFKILADETRLGIVLLLSELGELCVCDLCTALDQSQPKISRHLALLRESGLLLDRKQGKWVHY RLSPHIPAWAAKIIDEAWRCEQEKVQAIVRNLARQNCSGDSKNICSLEHHHHHH
Molecular weight 15,33 kDa
Protein delivered with Tag? Yes
Purity estimated 80% (DENATURED)
Buffer PBS, 300mM in native conditions. PBS, Urea 8M, imidazole 10mM in denaturing conditions
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession ZP_03049476.1
NCBI Reference ZP_03049476.1
Aliases /Synonyms ArsR E coli optimized, arsenical resistance operon repressor
Reference PX-P1071
Note For research use only
Molecular Constructor
Partial Yes

E. coli ArsR Nter FLAG and Cter His Recombinant Protein

There are no reviews yet.

Be the first to review “E. coli ArsR Nter FLAG and Cter His Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products