Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant DENV-2 Envelope protein E, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Dengue virus type 2 (strain Thailand/PUO-218/1980) (DENV-2)
Uniprot ID:
P18356
Molecular weight:
13.73 kDa

Original price was: €262.00.Current price is: €230.00.

50ug 12% OFF + 230 loyalty points
Met477–Gln580
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant DENV-2 Envelope protein E, N-His

Product name ARO-P12713-100
Uniprot ID P18356
Origin species Dengue virus type 2 (strain Thailand/PUO-218/1980) (DENV-2)
Expression system Prokaryotic expression
Raw Antigen Sequence MSYSMCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKKGSSI
Molecular weight 13.73 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met477-Gln580
Aliases /Synonyms Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5, Dengue Virus (DENV)
Reference ARO-P12713
Note For research use only.
Molecular Constructor
Met477–Gln580
Product name ARO-P12713-1MG
Uniprot ID P18356
Origin species Dengue virus type 2 (strain Thailand/PUO-218/1980) (DENV-2)
Expression system Prokaryotic expression
Raw Antigen Sequence MSYSMCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKKGSSI
Molecular weight 13.73 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met477-Gln580
Aliases /Synonyms Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5, Dengue Virus (DENV)
Reference ARO-P12713
Note For research use only.
Molecular Constructor
Met477–Gln580
Product name ARO-P12713-50
Uniprot ID P18356
Origin species Dengue virus type 2 (strain Thailand/PUO-218/1980) (DENV-2)
Expression system Prokaryotic expression
Raw Antigen Sequence MSYSMCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKKGSSI
Molecular weight 13.73 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met477-Gln580
Aliases /Synonyms Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5, Dengue Virus (DENV)
Reference ARO-P12713
Note For research use only.
Molecular Constructor
Met477–Gln580

Introduction

Recombinant DENV-2 Envelope protein E is a key component of the Dengue virus, which is a mosquito-borne virus that causes Dengue fever. The Dengue virus has four distinct serotypes (DENV-1, DENV-2, DENV-3, and DENV-4) and the Envelope protein E is a major antigenic component of all four serotypes. In this article, we will discuss the structure, activity, and application of Recombinant DENV-2 Envelope protein E.

Structure of Recombinant DENV-2 Envelope protein E

The Envelope protein E is a glycoprotein that is found on the surface of the Dengue virus. It is a type I transmembrane protein that consists of three domains: domain I, II, and III. Domain I and II are located on the outer surface of the virus, while domain III is buried within the viral envelope. The protein has a molecular weight of approximately 50 kDa and is composed of 495 amino acids.

Domain I

Domain I is the central domain of the Envelope protein E and is responsible for receptor binding and fusion with the host cell membrane. It is composed of 80 amino acids and contains a highly conserved fusion loop that is essential for viral entry into the host cell.

Domain II

Domain II is the dimerization domain of the Envelope protein E and is responsible for the formation of the viral envelope. It consists of 50 amino acids and is highly conserved among all four serotypes of Dengue virus.

Domain III

Domain III is the immunoglobulin-like domain of the Envelope protein E and is responsible for eliciting neutralizing antibodies. It is composed of 175 amino acids and contains the majority of the antigenic sites of the protein.

Activity of Recombinant DENV-2 Envelope protein E

The Envelope protein E plays a crucial role in the pathogenesis of Dengue virus infection. It is involved in viral entry into the host cell and is a major target for neutralizing antibodies. The fusion loop of domain I is responsible for binding to the host cell receptor, while domain III is responsible for eliciting neutralizing antibodies.

Receptor binding

The Envelope protein E binds to the host cell receptor, which is a protein called DC-SIGN, through its fusion loop in domain I. This interaction triggers a conformational change in the protein, exposing domain II, which then mediates fusion between the viral and host cell membranes.

Neutralizing antibodies

Domain III of the Envelope protein E contains the majority of the antigenic sites of the protein. These sites are targeted by neutralizing antibodies, which prevent the virus from entering the host cell and causing infection. This makes the Envelope protein E a key target for vaccine development against Dengue virus.

Application of Recombinant DENV-2 Envelope protein E

Recombinant DENV-2 Envelope protein E has several applications in the field of Dengue virus research and vaccine development.

Vaccine development

The Envelope protein E is a major target for vaccine development against Dengue virus. Recombinant forms of the protein can be produced in large quantities and used to elicit neutralizing antibodies in the host, providing protection against infection.

Diagnostic tool

Recombinant DENV-2 Envelope protein E can also be used as a diagnostic tool for Dengue virus infection. Antibodies against the protein can be used to detect the presence of the virus in patient samples, allowing for early diagnosis and treatment.

Research tool

The Envelope protein E is also a valuable tool for studying the structure and function of the Dengue virus. Recombinant forms of the protein can be used in various experiments to understand the mechanisms of viral entry and the role of the protein in

Recombinant DENV-2 Envelope protein E, N-His

There are no reviews yet.

Be the first to review “Recombinant DENV-2 Envelope protein E, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products