Zea mays ASR1 Recombinant Protein

Reference:
Size

10ug, 100ug

Brand

Product type

Host Species

Product nameZea mays ASR1 Recombinant Protein
Uniprot IDD1MN58
Uniprot linkhttp://www.uniprot.org/uniprot/D1MN58
Origin speciesZea mays
Expression systemProcaryotic expression
SequenceMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMAEEKHHHH HLFHHKKDEEQEEQLAGGGYGESAEYTEATVTEVVSTGENEYDEYKEEKQHKHKQHLGEAGAIAAGAFALYEKHEAKKDP EHAHRHKIEEEVAAAAAVGSGGFAFHEHHEKKKDHKDAEEAGGEKKHHFFG
Molecular weight42,53 kDa
Protein delivered with Tag?No
Purity estimated80% (with degraded bands)
Buffer3C-protease cleavage buffer: TrisHC 50mMl, NaCl 150mM, EDTA 1mM, DTT 1mM, pH7
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days2-3
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeFull-length
Protein AccessionCAA72998.1
Spec:SwissProtIDD1MN58
NCBI ReferenceCAA72998.1
Aliases /SynonymsASR1, ABA-, stress-and fruit-ripening inducible-like protein
ReferencePX-P1053
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Zea mays ASR1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.