Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Zea mays ASR1 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Zea mays
Uniprot ID:
D1MN58
Molecular weight:
42,53 kDa

€210.00

50ug + 210 loyalty points
Full-length No
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Zea mays ASR1 Recombinant Protein

Zea mays ASR1 Recombinant Protein

Product name Zea mays ASR1 Recombinant Protein
Uniprot ID D1MN58
Uniprot link http://www.uniprot.org/uniprot/D1MN58
Origin species Zea mays
Expression system Prokaryotic expression
Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMAEEKHHHH HLFHHKKDEEQEEQLAGGGYGESAEYTEATVTEVVSTGENEYDEYKEEKQHKHKQHLGEAGAIAAGAFALYEKHEAKKDP EHAHRHKIEEEVAAAAAVGSGGFAFHEHHEKKKDHKDAEEAGGEKKHHFFG
Molecular weight 42,53 kDa
Protein delivered with Tag? No
Purity estimated 80% (with degraded bands)
Buffer 3C-protease cleavage buffer: TrisHC 50mMl, NaCl 150mM, EDTA 1mM, DTT 1mM, pH7
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 2-3
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession CAA72998.1
Spec:SwissProtID D1MN58
NCBI Reference CAA72998.1
Aliases /Synonyms ASR1, ABA-, stress-and fruit-ripening inducible-like protein
Reference PX-P1053
Note For research use only
Molecular Constructor
Full-length No
Product name Zea mays ASR1 Recombinant Protein
Uniprot ID D1MN58
Uniprot link http://www.uniprot.org/uniprot/D1MN58
Origin species Zea mays
Expression system Prokaryotic expression
Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMAEEKHHHH HLFHHKKDEEQEEQLAGGGYGESAEYTEATVTEVVSTGENEYDEYKEEKQHKHKQHLGEAGAIAAGAFALYEKHEAKKDP EHAHRHKIEEEVAAAAAVGSGGFAFHEHHEKKKDHKDAEEAGGEKKHHFFG
Molecular weight 42,53 kDa
Protein delivered with Tag? No
Purity estimated 80% (with degraded bands)
Buffer 3C-protease cleavage buffer: TrisHC 50mMl, NaCl 150mM, EDTA 1mM, DTT 1mM, pH7
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 2-3
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession CAA72998.1
Spec:SwissProtID D1MN58
NCBI Reference CAA72998.1
Aliases /Synonyms ASR1, ABA-, stress-and fruit-ripening inducible-like protein
Reference PX-P1053
Note For research use only
Molecular Constructor
Full-length No

There are no reviews yet.

Be the first to review “Zea mays ASR1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products