Toxoplasma gondii GRA6(43-230)(RH) Recombinant Protein

Reference:
Size

10ug, 100ug

Brand

Product type

Host Species

Product nameToxoplasma gondii GRA6(43-230)(RH) Recombinant Protein
Uniprot IDQ27003
Uniprot linkhttp://www.uniprot.org/uniprot/Q27003
Origin speciesToxoplasma gondii
Expression systemProcaryotic expression
SequenceMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLAADSGGVKQTPSETGSSGGQQEAVGTTEDYVNSSAMGGGQGDSL AEDDTTSEAAEGDVDPFPVLANEGKSEARGPSLEERIEEQGTRRRYSSVQEPQAKVPSKRTQKRHRLIGAVVLAVSVAML TAFFLRRTGRRSPQEPSGDGGGNDAGNNAGNGGNEGRGYGGRGEGGAEDDRRPLHPERVNVFDYAAALEHHHHHH
Molecular weight24,91 kDa
Protein delivered with Tag?Yes
Purity estimated70% native, 80% denatured
BufferPBS, imidazole 300mM in native conditions. NaH2PO4 100mM, TrisBase 10mM, Urea 8M, imidazole 400mM in denaturig conditions
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionAAC37235.1
Spec:SwissProtIDQ27003
NCBI ReferenceAAC37235.1
Aliases /SynonymsGRA6(43-230)(RH), dense granule antigen, Dense granule protein 6, GRA6, GRA 6, Antigen p32, Protein p33, TG24
ReferencePX-P1097
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Toxoplasma gondii GRA6(43-230)(RH) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.