Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Candida albicans CSA2 Protein, C-His

Host species:
Yeast
Origin species:
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Uniprot ID:
Q5A0X8
Molecular weight:
22.49 kDa

Original price was: €311.00.Current price is: €241.00.

50ug 23% OFF + 241 loyalty points
Asn34–Asn147
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Candida albicans CSA2 Protein, C-His

Product name ARO-P10899-100
Uniprot ID Q5A0X8
Origin species Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Expression system Eukaryotic expression
Raw Antigen Sequence NPYTIYPPVPKTASINGFADRIYDQIPKCAQECVKQSTSSTPCPYWDTGCLCVIPNFTGAVGNCVASKCRGADVTNFRKLAVGACAAAGVWDPYWIIPASVSSALDAAATATGN
Molecular weight 22.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Yeast
Fragment Type Asn34-Asn147
Aliases /Synonyms Secreted hemophore CSA2, Surface antigen protein 2, CSA2, CRW1, CAALFM_C406920CA, CaO19.10629, CaO19.3117
Reference ARO-P10899
Note For research use only.
Molecular Constructor
Asn34–Asn147
Product name ARO-P10899-1MG
Uniprot ID Q5A0X8
Origin species Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Expression system Eukaryotic expression
Raw Antigen Sequence NPYTIYPPVPKTASINGFADRIYDQIPKCAQECVKQSTSSTPCPYWDTGCLCVIPNFTGAVGNCVASKCRGADVTNFRKLAVGACAAAGVWDPYWIIPASVSSALDAAATATGN
Molecular weight 22.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Yeast
Fragment Type Asn34-Asn147
Aliases /Synonyms Secreted hemophore CSA2, Surface antigen protein 2, CSA2, CRW1, CAALFM_C406920CA, CaO19.10629, CaO19.3117
Reference ARO-P10899
Note For research use only.
Molecular Constructor
Asn34–Asn147
Product name ARO-P10899-50
Uniprot ID Q5A0X8
Origin species Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Expression system Eukaryotic expression
Raw Antigen Sequence NPYTIYPPVPKTASINGFADRIYDQIPKCAQECVKQSTSSTPCPYWDTGCLCVIPNFTGAVGNCVASKCRGADVTNFRKLAVGACAAAGVWDPYWIIPASVSSALDAAATATGN
Molecular weight 22.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Yeast
Fragment Type Asn34-Asn147
Aliases /Synonyms Secreted hemophore CSA2, Surface antigen protein 2, CSA2, CRW1, CAALFM_C406920CA, CaO19.10629, CaO19.3117
Reference ARO-P10899
Note For research use only.
Molecular Constructor
Asn34–Asn147

Recombinant Candida albicans CSA2 Protein, C-His

There are no reviews yet.

Be the first to review “Recombinant Candida albicans CSA2 Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products