Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Trypsinogen

Host species:
Yeast
Uniprot ID:
C5IWV5
Molecular weight:
25kDa

210.00

50ug + 210 loyalty points
Asp20–Asn246 His
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Trypsinogen

Product name Trypsinogen
Uniprot ID C5IWV5
Uniprot link https://www.uniprot.org/uniprot/C5IWV5
Expression system Eukaryotic expression
Raw Antigen Sequence DDDKIVGGYTCAANSVPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Molecular weight 25kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH 6.0
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Yeast
Fragment Type Asp20-Asn246
Protein Accession XP_020934123
Spec:Entrez GeneID 100302368
NCBI Reference XP_020934123
Aliases /Synonyms /
Reference PX-P4831
Note For research use only
Molecular Constructor
Asp20–Asn246 His
Product name Trypsinogen
Uniprot ID C5IWV5
Uniprot link https://www.uniprot.org/uniprot/C5IWV5
Expression system Eukaryotic expression
Raw Antigen Sequence DDDKIVGGYTCAANSVPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Molecular weight 25kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH 6.0
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Yeast
Fragment Type Asp20-Asn246
Protein Accession XP_020934123
Spec:Entrez GeneID 100302368
NCBI Reference XP_020934123
Aliases /Synonyms /
Reference PX-P4831
Note For research use only
Molecular Constructor
Asp20–Asn246 His

Trypsinogen

There are no reviews yet.

Be the first to review “Trypsinogen”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products