Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Glucose-6-phosphate exchanger SLC37A4 (in Yeast)

Host species:
Yeast
Origin species:
Homo sapiens (Human)
Uniprot ID:
O43826

210.00

50ug + 210 loyalty points
Met1–Cys176 His
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Glucose-6-phosphate exchanger SLC37A4 (in Yeast)

Product name Glucose-6-phosphate exchanger SLC37A4 (in Yeast)
Uniprot ID O43826
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MAAQGYGYYRTVIFSAMFGGYSLYYFNRKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSARWLFSSGLLLVGLVNIFFAWSSTVPVFAALWFLNGLAQGLGWPPCGKVLRKWFEPSQFGTWWAILSTSMNLAGGLGPILATILAQSYSWRSTLALSGALC
Protein delivered with Tag? C-terminal His Tag
Purity estimated >85%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Yeast
Fragment Type Met1-Cys176
Aliases /Synonyms Glucose-5-phosphate transporter,Glucose-6-phosphate translocase,G6PT, G6PT1
Reference PX-P4624
Note For research use only
Molecular Constructor
Met1–Cys176 His
Product name Glucose-6-phosphate exchanger SLC37A4 (in Yeast)
Uniprot ID O43826
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MAAQGYGYYRTVIFSAMFGGYSLYYFNRKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSARWLFSSGLLLVGLVNIFFAWSSTVPVFAALWFLNGLAQGLGWPPCGKVLRKWFEPSQFGTWWAILSTSMNLAGGLGPILATILAQSYSWRSTLALSGALC
Protein delivered with Tag? C-terminal His Tag
Purity estimated >85%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Yeast
Fragment Type Met1-Cys176
Aliases /Synonyms Glucose-5-phosphate transporter,Glucose-6-phosphate translocase,G6PT, G6PT1
Reference PX-P4624
Note For research use only
Molecular Constructor
Met1–Cys176 His

Glucose-6-phosphate exchanger SLC37A4 (in Yeast)

There are no reviews yet.

Be the first to review “Glucose-6-phosphate exchanger SLC37A4 (in Yeast)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products