Tilapia nilotica HSP70 Recombinant Protein

Reference:
Product nameTilapia nilotica HSP70 Recombinant Protein
Uniprot IDB6E947
Uniprot linkhttp://www.uniprot.org/uniprot/B6E947
Origin speciesTilapia nilotica
Expression systemEukaryotic expression
SequenceMSAAKGVAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ VALNPSNTVFDAKRLIGRKFDEPVVQADMKHWPFKVISDGGKPKIRVEYKGEDKAFYPEE ISSMVLVKMKEIAEAYLGQKVSNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA AAIAYGLDKGKSGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMV NHFVEEFKRKHKKDISQNKRALRRLRTACERAKRTLSSSSQASIEIDSLFEGVDFYTSIT RARFEELCSDLFRGTLEPVEKSLRDAKLDKGQIHDVVLVGGSTRIPKIQKLLQDFFNGRE LNKSINPDEAVAYGAAVQAAILSGDTSGNVQDLLLLDVAPLSLGIETAGGVMTALIKRNT TIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTF DVDANGILNVSAVDKSTGKENKITITNDKGRLSKEEIERMVQDAEKYKAEDDLQRDKIAA KNSLESYAFNMKSSVQDDNLKGKISEEDKKKVVEKCDEAIAWLENNQLADKEEYQHKQKE LEKVCNPIISKLYQGGMPTGATCGEQARAGSQGPTIEEVD
Molecular weight70.26 kDa
Protein delivered with Tag?Yes
Purity estimated90%
BufferTris 50mM, NaCl 150mM ,pH 8.0
FormFrozen
Delivery conditionDry Ice
Delivery lead time in business days5-7
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesYeast
Fragment TypeFull-length
NCBI ReferenceB6E947
Aliases /SynonymsHSP-A4, APG2, HS24/P52, RY, Hsp70, Hsp70RY, Heat shock 70-related protein APG-2
ReferencePX-P3054
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Tilapia nilotica HSP70 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Tilapia nilotica HSP70 Recombinant Protein
Receptor Tilapia nilotica HSP70 Recombinant Protein PX-P3054 135€

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.