Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Rat Resistin-like alpha(Retnla)

Host species:
Mammalian cells
Origin species:
Rattus norvegicus (Rat)
Uniprot ID:
Q99P85
Molecular weight:
35-40kDa

Original price was: €237.00.Current price is: €210.00.

50ug 11% OFF + 210 loyalty points
Met1~Ser111 Fc
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Rat Resistin-like alpha(Retnla)

Product name Rat Resistin-like alpha(Retnla)
Uniprot ID Q99P85
Uniprot link https://www.uniprot.org/uniprot/Q99P85
Origin species Rattus norvegicus (Rat)
Expression system Eukaryotic expression
Raw Antigen Sequence MKTATCSLLICVFLLQLMVPVNTDGTLDIIGKKKVKELLAHQDNYPSAVRKTLSCTNVKSMSKWASCPAGMTATGCSCGFACGSWEIQNENICNCLCLIVDWAYARCCQLS
Molecular weight 35-40kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90% by SDS-PAGE
Buffer Tris-glycine
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Ser111
Protein Accession Q99P85
Spec:Entrez GeneID 81712
Spec:NCBI Gene Aliases Himf
NCBI Reference Q99P85
Aliases /Synonyms Fizz1,Cysteine-rich secreted protein FIZZ1,RELMalpha
Reference PX-P4554
Note For research use only
Molecular Constructor
Met1~Ser111 Fc
Product name Rat Resistin-like alpha(Retnla)
Uniprot ID Q99P85
Uniprot link https://www.uniprot.org/uniprot/Q99P85
Origin species Rattus norvegicus (Rat)
Expression system Eukaryotic expression
Raw Antigen Sequence MKTATCSLLICVFLLQLMVPVNTDGTLDIIGKKKVKELLAHQDNYPSAVRKTLSCTNVKSMSKWASCPAGMTATGCSCGFACGSWEIQNENICNCLCLIVDWAYARCCQLS
Molecular weight 35-40kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90% by SDS-PAGE
Buffer Tris-glycine
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Ser111
Protein Accession Q99P85
Spec:Entrez GeneID 81712
Spec:NCBI Gene Aliases Himf
NCBI Reference Q99P85
Aliases /Synonyms Fizz1,Cysteine-rich secreted protein FIZZ1,RELMalpha
Reference PX-P4554
Note For research use only
Molecular Constructor
Met1~Ser111 Fc
Product name PX-P4554-1MG
Uniprot ID Q99P85
Uniprot link https://www.uniprot.org/uniprot/Q99P85
Origin species Rattus norvegicus (Rat)
Expression system Eukaryotic expression
Raw Antigen Sequence MKTATCSLLICVFLLQLMVPVNTDGTLDIIGKKKVKELLAHQDNYPSAVRKTLSCTNVKSMSKWASCPAGMTATGCSCGFACGSWEIQNENICNCLCLIVDWAYARCCQLS
Molecular weight 35-40kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90% by SDS-PAGE
Buffer Tris-glycine
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Ser111
Protein Accession Q99P85
Spec:Entrez GeneID 81712
Spec:NCBI Gene Aliases Himf
NCBI Reference Q99P85
Aliases /Synonyms Fizz1,Cysteine-rich secreted protein FIZZ1,RELMalpha
Reference PX-P4554
Note For research use only
Molecular Constructor
Met1~Ser111 Fc

Rat Resistin-like alpha(Retnla)

There are no reviews yet.

Be the first to review “Rat Resistin-like alpha(Retnla)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products