Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human FLT1 recombinant protein

  • PX-P6096
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P17948
Molecular weight:
37.77 kDa

420.00

100ug + 420 loyalty points
Met1–Ile328 His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human FLT1 recombinant protein

Product name Human FLT1 recombinant protein
Uniprot ID P17948
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHI
Molecular weight 37.77 kDa
Protein delivered with Tag? C-Terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ile328
Aliases /Synonyms FLT1, Vascular endothelial Growth Factor proteins receptor 1, VEGFR1, Vascular permeability factor receptor, FRT, Tyrosine-protein kinase receptor FLT, VEGFR-1, FLT, FLT-1, Tyrosine-protein kinase FRT, Fms-like tyrosine kinase 1, Drug Target
Reference PX-P6096
Note For research use only
Molecular Constructor
Met1–Ile328 His

General information on Human FLT1 recombinant protein

Human FLT1 Recombinant Protein: Structure and Activity

Human Fms-like tyrosine kinase 1 (FLT1) is a type I membrane receptor belonging to the vascular endothelial growth factor receptor (VEGFR) family. It is composed of an extracellular domain, a single transmembrane domain, and an intracellular domain. The extracellular domain of FLT1 binds to VEGF-A, VEGF-C, and VEGF-D, while the intracellular domain has tyrosine kinase activity. FLT1 is involved in the regulation of angiogenesis, vascular permeability, and cell proliferation.

FLT1 as an Antibody-Drug Target

FLT1 is an attractive target for antibody-drug conjugates (ADCs) due to its role in tumor growth and angiogenesis. ADCs are composed of an antibody linked to a cytotoxic drug. The antibody binds to the FLT1 receptor and the drug is internalized, leading to cell death. FLT1-targeted ADCs have been used in clinical trials for various types of cancer, including ovarian, gastric, and colorectal cancers.

Icrucumab Biosimilar - Anti-FLT1, VEGFR-1 mAb binds to Human FLT1 recombinant protein in indirect ELISA Assay

Icrucumab Biosimilar - Anti-FLT1, VEGFR-1 mAb binds to Human FLT1 recombinant protein in indirect ELISA Assay

Immobilized Human FLT1 recombinant protein (cat. No.PX-P6096) at 0.5µg/mL (100µL/well) can bind to Icrucumab Biosimilar - Anti-FLT1, VEGFR-1 mAb (cat. No.PX-TA1257) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Human FLT1 recombinant protein

There are no reviews yet.

Be the first to review “Human FLT1 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products