Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Quisovalimab Biosimilar – Anti-CD258 mAb – Research Grade

  • PX-TA1785-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: €175.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Quisovalimab Biosimilar - Anti-CD258 mAb - Research Grade

Product name Quisovalimab Biosimilar - Anti-CD258 mAb - Research Grade
Uniprot ID O43557
Source CAS: 2427667-03-4
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Quisovalimab,AEVI-002, CERC-002, F-19, MDGN-002, SAR-252067,CD258,anti-CD258
Reference PX-TA1785
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Quisovalimab Biosimilar - Anti-CD258 mAb - Research Grade
Uniprot ID O43557
Source CAS: 2427667-03-4
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Quisovalimab,AEVI-002, CERC-002, F-19, MDGN-002, SAR-252067,CD258,anti-CD258
Reference PX-TA1785
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1785-50
Uniprot ID O43557
Source CAS: 2427667-03-4
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Quisovalimab,AEVI-002, CERC-002, F-19, MDGN-002, SAR-252067,CD258,anti-CD258
Reference PX-TA1785
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction:

Quisovalimab Biosimilar, also known as Anti-CD258 mAb, is a research grade monoclonal antibody that targets the CD258 protein. This protein is found on the surface of certain immune cells and is involved in regulating the immune response. Quisovalimab Biosimilar has been developed as a potential therapeutic agent for various autoimmune and inflammatory diseases. In this article, we will explore the structure, activity, and potential applications of Quisovalimab Biosimilar.

Structure of Quisovalimab Biosimilar:

Quisovalimab Biosimilar is a monoclonal antibody, meaning it is produced from a single type of immune cell. It is a fully humanized antibody, meaning it is derived from human cells and has a high binding affinity for the CD258 protein. The antibody has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains. These chains are connected by disulfide bonds and form a Y-shaped structure.

Activity of Quisovalimab Biosimilar:

Quisovalimab Biosimilar binds to the CD258 protein on immune cells, specifically targeting a specific region known as the extracellular domain. This binding inhibits the interaction between CD258 and its ligand, leading to a decrease in the activation of immune cells. This results in a decrease in the production of pro-inflammatory cytokines and chemokines, which are responsible for the inflammatory response. Additionally, Quisovalimab Biosimilar also promotes the production of anti-inflammatory cytokines, further suppressing the immune response.

Applications of Quisovalimab Biosimilar:

1. Rheumatoid Arthritis: Rheumatoid arthritis is a chronic inflammatory disease that affects the joints. Quisovalimab Biosimilar has shown promising results in preclinical studies as a potential treatment for this condition. By inhibiting the activation of immune cells, it can reduce inflammation in the joints and alleviate symptoms such as pain and swelling.

2. Psoriasis: Psoriasis is a skin disorder characterized by red, scaly patches on the skin. It is caused by an overactive immune response. Quisovalimab Biosimilar has been shown to be effective in reducing the severity of psoriasis symptoms by targeting the immune cells responsible for the inflammatory response.

3. Inflammatory Bowel Disease (IBD): IBD is a group of chronic inflammatory conditions that affect the digestive tract. Quisovalimab Biosimilar has been shown to be effective in reducing inflammation in the gut and improving symptoms in preclinical studies. It has the potential to be used as a treatment for conditions such as Crohn’s disease and ulcerative colitis.

4. Multiple Sclerosis (MS): MS is an autoimmune disease that affects the central nervous system. Quisovalimab Biosimilar has shown promising results in preclinical studies as a potential treatment for MS. It can reduce inflammation in the brain and spinal cord, which can help alleviate symptoms such as muscle weakness and numbness.

5. Organ Transplantation: Organ transplantation can lead to rejection due to an immune response against the transplanted organ. Quisovalimab Biosimilar has the potential to be used as an immunosuppressant to prevent rejection in organ transplant recipients. By inhibiting the activation of immune cells, it can reduce the risk of rejection and improve the success of organ transplantation.

Conclusion:

Quisovalimab Biosimilar is a research grade monoclonal antibody with a high binding affinity for the CD258 protein. It has shown promising results in preclinical studies as a potential therapeutic agent for various autoimmune and inflammatory diseases. By targeting immune cells and inhibiting the inflammatory response, it has the potential to alleviate symptoms and improve the quality of life for patients. Further clinical studies are needed to fully evaluate the safety and efficacy of Quisovalimab Biosimilar in treating these conditions.

SDS-PAGE for Quisovalimab Biosimilar - Anti-CD258 mAb - Research Grade

SDS-PAGE for Quisovalimab Biosimilar - Anti-CD258 mAb - Research Grade

Quisovalimab Biosimilar - Anti-CD258 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SEC-HPLC of Quisovalimab Biosimilar - Anti-CD258 mAb - Research Grade

SEC-HPLC of Quisovalimab Biosimilar - Anti-CD258 mAb - Research Grade

Quisovalimab Biosimilar - Anti-CD258 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Quisovalimab Biosimilar - Anti-CD258 mAb - Research Grade

There are no reviews yet.

Be the first to review “Quisovalimab Biosimilar – Anti-CD258 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products