Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Prasinezumab Biosimilar – Anti-SNCA mAb – Research Grade

  • PX-TA1491-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €174.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Prasinezumab Biosimilar - Anti-SNCA mAb - Research Grade

Product name Prasinezumab Biosimilar - Anti-SNCA mAb - Research Grade
Uniprot ID P37840
Source CAS 1960462-19-4
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Prasinezumab,PRX002,RG-7935,SNCA,anti-SNCA
Reference PX-TA1491
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Prasinezumab Biosimilar - Anti-SNCA mAb - Research Grade
Uniprot ID P37840
Source CAS 1960462-19-4
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Prasinezumab,PRX002,RG-7935,SNCA,anti-SNCA
Reference PX-TA1491
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1491-50
Uniprot ID P37840
Source CAS 1960462-19-4
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Prasinezumab,PRX002,RG-7935,SNCA,anti-SNCA
Reference PX-TA1491
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Prasinezumab Biosimilar, also known as Anti-SNCA mAb, is a monoclonal antibody that has been developed as a potential therapeutic agent for Parkinson’s disease. This biosimilar is designed to target the alpha-synuclein (SNCA) protein, which is believed to play a key role in the pathogenesis of Parkinson’s disease. In this article, we will discuss the structure, activity, and potential applications of Prasinezumab Biosimilar as a research-grade antibody.

Structure of Prasinezumab Biosimilar

Prasinezumab Biosimilar is a recombinant humanized monoclonal antibody that is composed of two identical heavy chains and two identical light chains. The heavy chains are approximately 50 kDa in size and consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH). The light chains are approximately 25 kDa in size and consist of two constant domains (CL and CL2) and one variable domain (VL). The variable domains of both the heavy and light chains are responsible for binding to the SNCA protein.

Activity of Prasinezumab Biosimilar

Prasinezumab Biosimilar works by specifically binding to the SNCA protein, preventing its aggregation and subsequent formation of Lewy bodies, which are a hallmark of Parkinson’s disease. This binding also promotes the clearance of SNCA protein from the brain, reducing its toxic effects on dopaminergic neurons. In preclinical studies, Prasinezumab Biosimilar has been shown to effectively reduce SNCA levels and improve motor function in animal models of Parkinson’s disease.

Application as a Research-Grade Antibody

Prasinezumab Biosimilar is currently being developed as a research-grade antibody for use in laboratory studies and clinical trials. Its potential applications include:

1. Target Validation Studies As a specific and potent binder of SNCA protein, Prasinezumab Biosimilar can be used to validate the role of SNCA in the pathogenesis of Parkinson’s disease. This antibody can be used in in vitro and in vivo studies to investigate the effects of SNCA inhibition on disease progression and motor function.

2. Biomarker Development Prasinezumab Biosimilar can also be used to develop biomarkers for Parkinson’s disease. By measuring the levels of SNCA protein in biological samples, such as cerebrospinal fluid or blood, this antibody can help identify individuals at risk for developing Parkinson’s disease and monitor disease progression.

3. Therapeutic Development The promising preclinical data of Prasinezumab Biosimilar make it a potential candidate for therapeutic development. Clinical trials are currently underway to evaluate its safety and efficacy in patients with Parkinson’s disease. If successful, this antibody could provide a much-needed disease-modifying treatment for this debilitating condition.

4. Drug Screening Prasinezumab Biosimilar can also be used in drug screening assays to identify small molecules or other biologics that can inhibit SNCA aggregation or promote its clearance. This approach can aid in the discovery of novel treatments for Parkinson’s disease.

Conclusion

In summary, Prasinezumab Biosimilar is a promising research-grade antibody that specifically targets the SNCA protein, a key player in the pathogenesis of Parkinson’s disease. Its potential applications in target validation, biomarker development, therapeutic development, and drug screening make it a valuable tool for research in this field. Further studies and clinical trials are needed to fully explore the potential of this antibody as a treatment for Parkinson’s disease.

SDS-PAGE for Prasinezumab Biosimilar - Anti-SNCA mAb - Research Grade

SDS-PAGE for Prasinezumab Biosimilar - Anti-SNCA mAb - Research Grade

Prasinezumab Biosimilar - Anti-SNCA mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Prasinezumab Biosimilar - Anti-SNCA mAb - Research Grade in WB Assay

Prasinezumab Biosimilar - Anti-SNCA mAb - Research Grade in WB Assay

Prasinezumab Biosimilar - Anti-SNCA mAb - Research Grade can bind to its target in Western Blot Assay as detected on gel analysis.

Prasinezumab Biosimilar - Anti-SNCA mAb - Research Grade

There are no reviews yet.

Be the first to review “Prasinezumab Biosimilar – Anti-SNCA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products