Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

PAPD5 HUMAN Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q8NDF8
Molecular weight:
64.29kDa

Original price was: €209.00.Current price is: €182.00.

50ug 13% OFF + 182 loyalty points
Gly116–Gly433
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

PAPD5 HUMAN Protein

Product name PAPD5 HUMAN Protein
Uniprot ID Q8NDF8
Uniprot link https://www.uniprot.org/uniprot/Q8NDF8
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GVVGLHEEISDFYEYMSPRPEEEKMRMEVVNRIESVIKELWPSADVQIFGSFKTGLYLPTSDIDLVVFGKWENLPLWTLEEALRKHKVADEDSVKVLDKATVPIIKLTDSFTEVKVDISFNVQNGVRAADLIKDFTKKYPVLPYLVLVLKQFLLQRDLNEVFTGGIGSYSLFLMAVSFLQLHPREDACIPNTNYGVLLIEFFELYGRHFNYLKTGIRIKDGGSYVAKDEVQKNMLDGYRPSMLYIEDPLQPGNDVGRSSYGAMQVKQAFDYAYVVLSHAVSPIAKYYPNNETESILGRIIRVTDEVATYRDWISKQWG
Molecular weight 64.29kDa
Purity estimated 85%
Buffer TBS pH7.5 with urea 4M
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly116-Gly433
Aliases /Synonyms Terminal nucleotidyltransferase 4B, TENT4B, Non-canonical poly(A) RNA polymerase PAPD5, PAP-associated domain-containing protein 5, Terminal guanylyltransferase, Terminaluridylyltransferase 3, TUTase 3, Topoisomerase-related function protein 4-2, TRF4-2
Reference PX-P4250
Note For research use only
Molecular Constructor
Gly116–Gly433
Product name PAPD5 HUMAN Protein
Uniprot ID Q8NDF8
Uniprot link https://www.uniprot.org/uniprot/Q8NDF8
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GVVGLHEEISDFYEYMSPRPEEEKMRMEVVNRIESVIKELWPSADVQIFGSFKTGLYLPTSDIDLVVFGKWENLPLWTLEEALRKHKVADEDSVKVLDKATVPIIKLTDSFTEVKVDISFNVQNGVRAADLIKDFTKKYPVLPYLVLVLKQFLLQRDLNEVFTGGIGSYSLFLMAVSFLQLHPREDACIPNTNYGVLLIEFFELYGRHFNYLKTGIRIKDGGSYVAKDEVQKNMLDGYRPSMLYIEDPLQPGNDVGRSSYGAMQVKQAFDYAYVVLSHAVSPIAKYYPNNETESILGRIIRVTDEVATYRDWISKQWG
Molecular weight 64.29kDa
Purity estimated 85%
Buffer TBS pH7.5 with urea 4M
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly116-Gly433
Aliases /Synonyms Terminal nucleotidyltransferase 4B, TENT4B, Non-canonical poly(A) RNA polymerase PAPD5, PAP-associated domain-containing protein 5, Terminal guanylyltransferase, Terminaluridylyltransferase 3, TUTase 3, Topoisomerase-related function protein 4-2, TRF4-2
Reference PX-P4250
Note For research use only
Molecular Constructor
Gly116–Gly433
Product name PX-P4250-1MG
Uniprot ID Q8NDF8
Uniprot link https://www.uniprot.org/uniprot/Q8NDF8
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GVVGLHEEISDFYEYMSPRPEEEKMRMEVVNRIESVIKELWPSADVQIFGSFKTGLYLPTSDIDLVVFGKWENLPLWTLEEALRKHKVADEDSVKVLDKATVPIIKLTDSFTEVKVDISFNVQNGVRAADLIKDFTKKYPVLPYLVLVLKQFLLQRDLNEVFTGGIGSYSLFLMAVSFLQLHPREDACIPNTNYGVLLIEFFELYGRHFNYLKTGIRIKDGGSYVAKDEVQKNMLDGYRPSMLYIEDPLQPGNDVGRSSYGAMQVKQAFDYAYVVLSHAVSPIAKYYPNNETESILGRIIRVTDEVATYRDWISKQWG
Molecular weight 64.29kDa
Purity estimated 85%
Buffer TBS pH7.5 with urea 4M
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly116-Gly433
Aliases /Synonyms Terminal nucleotidyltransferase 4B, TENT4B, Non-canonical poly(A) RNA polymerase PAPD5, PAP-associated domain-containing protein 5, Terminal guanylyltransferase, Terminaluridylyltransferase 3, TUTase 3, Topoisomerase-related function protein 4-2, TRF4-2
Reference PX-P4250
Note For research use only
Molecular Constructor
Gly116–Gly433

General information on PAPD5 Human Protein

PAPD5 protein is a member of non-canonical poly(a) polymerases also known as Cidl1-like proteins. Non-canonical poly(A) polymerases are very similar to canonical poly(a) polymerases but have different nucleotide-base recognition motif. The latter are responsible for the addition of a poly(A) tail to the 3’ end by poly(A) polymerases to mRNAs which leads to their degradation. Non canonical PAPs, such as PAPD5 protein, are responsible for the cytoplasmic polyadenylation of mRNAs and polyadenylation mediated degradation of RNAs. Other members of this family of proteins may also be involved in the addition of uridyl residues of RNAs.
Human PAPD5 protein is involved in the polyadenylation-mediated degradation of aberrant pre-rRNAs. This protein has also been reported to be involved in the degradation of replication-dependent histone mRNAs. These mRNAs do not have a poly(A) tail but end in a stem-loop structure. In this case, the degradation pathway starts with PAPD5 protein adding a poly(U) tail which is recognized by the Lsm1-7 complex. This recognition leads to decapping and degradation of the mRNAs. Other functions of PAPD5 protein include DNA binding, DNA-directed DNA polymerase activity, guanylyltransferase activity, metal ion binding, polynucleotide adenylyltransferase activity, RNA binding, telomerase RNA binding. PAPD5 protein is involved in cell division, cell cycle carbohydrate homeostasis and other biological processes.
PAPD5 protein is believed to act as a kind of scavenger enzyme for aberrant RNAs which, due to misfolding and misprocessing, cannot form the correct interactions. This function is similar to the role of TRAMP4 complex in yeast. Like the latter, PAPD5 protein can be found in nucleus which suggests that the protein may be part of a nuclear surveillance machinery. The downregulation of PAPD5 may not lead to a significant change in RNA level. This seems to suggest that the RNA surveillance system is most likely reductant, making sure that deleterious aberrant RNAs are degraded with high efficiency.

PAPD5 HUMAN Protein

There are no reviews yet.

Be the first to review “PAPD5 HUMAN Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products