Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human DJ1 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q99497
Molecular weight:
47,02 kDa

€210.00

50ug + 210 loyalty points
Full-length No
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Human DJ1 Recombinant Protein

Human DJ1 Recombinant Protein

Product name Human DJ1 Recombinant Protein
Uniprot ID Q99497
Uniprot link http://www.uniprot.org/uniprot/Q99497
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFMASKRA LVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESA AVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFAL AIVEALNGKEVAAQVKAPLVLKD
Molecular weight 47,02 kDa
Protein delivered with Tag? No
Purity estimated >95%
Buffer TrisHC 50mMl, NaCl 150mM, EDTA 1mM, DTT 1mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession Q99497 (Unipro
Spec:Entrez GeneID 11315
Spec:NCBI Gene Aliases DJ-1, DJ1, HEL-S-67p
Spec:SwissProtID Q99497
NCBI Reference Q99497 (Uniprot)
Aliases /Synonyms DJ1, protein DJ-1 (Alias: Oncogene DJ1 Parkinson disease protein 7)
Reference PX-P1084
Note For research use only
Molecular Constructor
Full-length No
Product name Human DJ1 Recombinant Protein
Uniprot ID Q99497
Uniprot link http://www.uniprot.org/uniprot/Q99497
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFMASKRA LVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESA AVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFAL AIVEALNGKEVAAQVKAPLVLKD
Molecular weight 47,02 kDa
Protein delivered with Tag? No
Purity estimated >95%
Buffer TrisHC 50mMl, NaCl 150mM, EDTA 1mM, DTT 1mM
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession Q99497 (Unipro
Spec:Entrez GeneID 11315
Spec:NCBI Gene Aliases DJ-1, DJ1, HEL-S-67p
Spec:SwissProtID Q99497
NCBI Reference Q99497 (Uniprot)
Aliases /Synonyms DJ1, protein DJ-1 (Alias: Oncogene DJ1 Parkinson disease protein 7)
Reference PX-P1084
Note For research use only
Molecular Constructor
Full-length No

There are no reviews yet.

Be the first to review “Human DJ1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products