Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

N-acyl homoserine lactonase(aiiA)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q9L8R8
Molecular weight:
29.3kDa

Original price was: €209.00.Current price is: €182.00.

50ug 13% OFF + 182 loyalty points
His Met1–IIe250
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

N-acyl homoserine lactonase(aiiA)

Product name N-acyl homoserine lactonase(aiiA)
Uniprot ID Q9L8R8
Uniprot link https://www.uniprot.org/uniprot/Q9L8R8
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGMTVKKLYFVPAGRCMLDHSSVNSTLTPGELLDLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFV EGQILPKMTEEDRIVNILKRVGYEPEDLLYIISSHLHFDHAGGNGAFINTPIIVQRAEYEAAQHSEEYLKECILPNLNYK IIEGDYEVVSGVQLLHTPGHTPGHQSLLIETEKSGSVLLTIDASYTKENFEEEVPFAGFDPELALSSIKRLKEVVIKEKP IVFFGHDIEQEKGCKVFPEYI
Molecular weight 29.3kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-IIe250
Protein Accession Q9L8R8
NCBI Reference Q9L8R8
Aliases /Synonyms AHL-lactonase,Acyl-homoserine lactonase
Reference PX-P4602
Note For research use only
Molecular Constructor
His Met1–IIe250
Product name N-acyl homoserine lactonase(aiiA)
Uniprot ID Q9L8R8
Uniprot link https://www.uniprot.org/uniprot/Q9L8R8
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGMTVKKLYFVPAGRCMLDHSSVNSTLTPGELLDLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFV EGQILPKMTEEDRIVNILKRVGYEPEDLLYIISSHLHFDHAGGNGAFINTPIIVQRAEYEAAQHSEEYLKECILPNLNYK IIEGDYEVVSGVQLLHTPGHTPGHQSLLIETEKSGSVLLTIDASYTKENFEEEVPFAGFDPELALSSIKRLKEVVIKEKP IVFFGHDIEQEKGCKVFPEYI
Molecular weight 29.3kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-IIe250
Protein Accession Q9L8R8
NCBI Reference Q9L8R8
Aliases /Synonyms AHL-lactonase,Acyl-homoserine lactonase
Reference PX-P4602
Note For research use only
Molecular Constructor
His Met1–IIe250
Product name PX-P4602-1MG
Uniprot ID Q9L8R8
Uniprot link https://www.uniprot.org/uniprot/Q9L8R8
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGMTVKKLYFVPAGRCMLDHSSVNSTLTPGELLDLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPEDLLYIISSHLHFDHAGGNGAFINTPIIVQRAEYEAAQHSEEYLKECILPNLNYKIIEGDYEVVSGVQLLHTPGHTPGHQSLLIETEKSGSVLLTIDASYTKENFEEEVPFAGFDPELALSSIKRLKEVVIKEKPIVFFGHDIEQEKGCKVFPEYI
Molecular weight 29.3kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS pH7.4, 0.02% NLS, 1mM EDTA, 4% trehalose, 1% mannitol
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-IIe250
Protein Accession Q9L8R8
NCBI Reference Q9L8R8
Aliases /Synonyms AHL-lactonase,Acyl-homoserine lactonase
Reference PX-P4602
Note For research use only.
Molecular Constructor
His Met1–IIe250

SDS-PAGE for N-acyl homoserine lactonase(aiiA)

SDS-PAGE for N-acyl homoserine lactonase(aiiA)

N-acyl homoserine lactonase(aiiA), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

N-acyl homoserine lactonase(aiiA)

  • Efremenko, E.; Aslanli, A.; Domnin, M.; Stepanov, N.; Senko, O. Enzymes with Lactonase Activity against Fungal Quorum Molecules as Effective Antifungals. Biomolecules 2024, 14, 383. https://doi.org/10.3390/biom14030383
  • Aysel Aslanli, Maksim Domnin, Nikolay Stepanov, Olga Senko, Elena Efremenko, Action enhancement of antimicrobial peptides by their combination with enzymes hydrolyzing fungal quorum molecules, International Journal of Biological Macromolecules, Volume 280, Part 4, 2024, 136066, ISSN 0141-8130, https://doi.org/10.1016/j.ijbiomac.2024.136066.

There are no reviews yet.

Be the first to review “N-acyl homoserine lactonase(aiiA)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products