Name: Mucin-4(MUC4)(1869-1925)
SKU: PX-P4275-10
Availability: InStock

Product name	Mucin-4(MUC4)(1869-1925)
Uniprot ID	Q99102
Uniprot link	https://www.uniprot.org/uniprot/Q99102
Origin species	Human
Expression system	Eukaryotic expression
Sequence	MESHMLLFLFSLATGLFGAVHGGSSFLCQNQSCPVNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCFLAGNNFSPTVNSGHHHHHH*
Molecular weight	9.55kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	/
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Insect
Applications	ELISA,WB
Fragment Type	Gly1869-Asn1925
Aliases /Synonyms	Ascites sialoglycoprotein,ASGP,Pancreatic adenocarcinoma mucin,Testis mucin,Tracheobronchial mucin
Reference	PX-P4275
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Mucin-4(MUC4)(1869-1925)”

Size

Clear

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PTX17851 180€

View product

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.