Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mannose-binding protein C(Mbl2)

Host species:
Insect
Uniprot ID:
P41317
Molecular weight:
26.86kDa

Original price was: €290.00.Current price is: €259.00.

50ug 11% OFF + 259 loyalty points
full length His-tag
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Mannose-binding protein C(Mbl2)

Product name Mannose-binding protein C(Mbl2)
Uniprot ID P41317
Uniprot link https://www.uniprot.org/uniprot/P41317
Expression system Eukaryotic expression
Raw Antigen Sequence MSIFTSFLLLCVVTVVYAETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD
Molecular weight 26.86kDa
Protein delivered with Tag? C-terminal His-tag
Purity estimated 90% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type full length
Protein Accession P41317
Spec:Entrez GeneID 17195
Spec:NCBI Gene Aliases MB; MBL; MBL-; MBP-; L-MBP; MBL-C; MBP-C; RARF/P28A
NCBI Reference P41317
Aliases /Synonyms MBP-C, RARF/P28A
Reference PX-P4531
Note For research use only
Molecular Constructor
full length His-tag
Product name Mannose-binding protein C(Mbl2)
Uniprot ID P41317
Uniprot link https://www.uniprot.org/uniprot/P41317
Expression system Eukaryotic expression
Raw Antigen Sequence MSIFTSFLLLCVVTVVYAETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD
Molecular weight 26.86kDa
Protein delivered with Tag? C-terminal His-tag
Purity estimated 90% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type full length
Protein Accession P41317
Spec:Entrez GeneID 17195
Spec:NCBI Gene Aliases MB; MBL; MBL-; MBP-; L-MBP; MBL-C; MBP-C; RARF/P28A
NCBI Reference P41317
Aliases /Synonyms MBP-C, RARF/P28A
Reference PX-P4531
Note For research use only
Molecular Constructor
full length His-tag
Product name PX-P4531-1MG
Uniprot ID P41317
Uniprot link https://www.uniprot.org/uniprot/P41317
Expression system Eukaryotic expression
Raw Antigen Sequence MSIFTSFLLLCVVTVVYAETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD
Molecular weight 26.86kDa
Protein delivered with Tag? C-terminal His-tag
Purity estimated 90% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type full length
Protein Accession P41317
Spec:Entrez GeneID 17195
Spec:NCBI Gene Aliases MB; MBL; MBL-; MBP-; L-MBP; MBL-C; MBP-C; RARF/P28A
NCBI Reference P41317
Aliases /Synonyms MBP-C, RARF/P28A
Reference PX-P4531
Note For research use only
Molecular Constructor
full length His-tag

Mannose-binding protein C(Mbl2)

There are no reviews yet.

Be the first to review “Mannose-binding protein C(Mbl2)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products