Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Monkeypox virus/MPXV B21R Recombinant Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Monkeypox virus (strain Zaire-96-I-16) (MPX)
Uniprot ID:
Q3I8H3
Molecular weight:
24.31 kDa

302.00

100ug + 302 loyalty points
His Thr291–Thr487
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Monkeypox virus/MPXV B21R Recombinant Protein, N-His

Monkeypox virus/MPXV B21R Recombinant Protein, N-His

Product name Monkeypox virus/MPXV B21R Recombinant Protein, N-His
Uniprot ID Q3I8H3
Origin species Monkeypox virus (strain Zaire-96-I-16) (MPX)
Expression system Prokaryotic expression
Raw Antigen Sequence TSNCDKCSMNLMASVIPAVNEFNNTLMKIGVKDDENNTVYNYYICKLTTNSTCDELINLDEVINNITLTNIIRNSVSTTNSRKRRDLNGEFEFSTSKELDCLYESYGVNDDISHCFASPRRRRSDDKKEYMDMKLFDHAKKDLGIDSVIPRGTTHFQVGASGASGGVVGDSFPFQNVKSRASLLAEKIMPRVPITAT
Molecular weight 24.31 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer Supplied as solution form in PBS pH 7.4.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr291-Thr487
Aliases /Synonyms B21R, Putative membrane-associated glycoprotein, Surface glycoprotein, MPXV-CAM1990_02-171, MPXV-Congo_8-172, MPXV-GAB1988_001-171, MPXV-Ikubi-171, MPXV_RCG2003_358_197, MPXV_SUD2005_01_192, MPXV_ZAI1979_005_197, MPXVgp182, Monkeypox virus (MPXV), clade 2
Reference PX-P6076
Note For research use only.
Molecular Constructor
His Thr291–Thr487

Monkeypox virus/MPXV B21R Recombinant Protein, N-His

There are no reviews yet.

Be the first to review “Monkeypox virus/MPXV B21R Recombinant Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products