Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mirzotamab Biosimilar – Anti-CD276, B7-H3 mAb – Research Grade

  • PX-TA1596-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €178.00.Current price is: €140.00.

50ug 21% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Mirzotamab Biosimilar - Anti-CD276, B7-H3 mAb - Research Grade

Product name Mirzotamab Biosimilar - Anti-CD276, B7-H3 mAb - Research Grade
Uniprot ID Q5ZPR3
Source CAS 2229859-11-2
Species Chimeric,Humanized
Expression system Mammalian cells
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Mirzotamab ,ABBV-155,CD276, B7-H3,anti-CD276, B7-H3
Reference PX-TA1596
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Mirzotamab Biosimilar - Anti-CD276, B7-H3 mAb - Research Grade
Uniprot ID Q5ZPR3
Source CAS 2229859-11-2
Species Chimeric,Humanized
Expression system Mammalian cells
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Mirzotamab ,ABBV-155,CD276, B7-H3,anti-CD276, B7-H3
Reference PX-TA1596
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1596-50
Uniprot ID Q5ZPR3
Source CAS 2229859-11-2
Species Chimeric,Humanized
Expression system Mammalian cells
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Mirzotamab ,ABBV-155,CD276, B7-H3,anti-CD276, B7-H3
Reference PX-TA1596
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Title: Mirzotamab Biosimilar – A Promising Antibody for Targeting B7-H3 in

Cancer Therapy Introduction:

Mirzotamab Biosimilar, also known as Anti-CD276 or B7-H3 mAb, is a novel monoclonal antibody that has shown promising results in cancer therapy. This biosimilar is designed to target B7-H3, a protein that is overexpressed in various types of cancer, making it an attractive therapeutic target. In this article, we will discuss the structure, mechanism of action, and potential applications of Mirzotamab Biosimilar in cancer treatment.

Structure of Mirzotamab Biosimilar:

Mirzotamab Biosimilar is a fully human monoclonal antibody with a molecular weight of approximately 150 kDa. It consists of two identical heavy chains and two identical light chains, connected by disulfide bonds. The heavy chain contains a constant region (Fc) and a variable region (Fab), while the light chain has only a variable region. The variable regions of both the heavy and light chains are responsible for binding to the target protein, B7-H3.

Mechanism of Action:

B7-H3 is a cell surface protein that is overexpressed in various types of cancer, including lung, breast, and prostate cancer. It plays a crucial role in tumor growth and progression by promoting angiogenesis, suppressing immune response, and enhancing tumor cell survival. Mirzotamab Biosimilar works by binding to B7-H3 and blocking its activity, thus inhibiting tumor growth and promoting immune response against cancer cells.

Applications of Mirzotamab Biosimilar:

1. Targeted Therapy for

Cancer:

Mirzotamab Biosimilar has shown promising results in preclinical studies as a targeted therapy for various types of cancer. In a study conducted on lung cancer cell lines, Mirzotamab Biosimilar was found to significantly inhibit tumor growth and induce cell death. Similarly, in a study on breast cancer, this biosimilar showed a significant reduction in tumor size and improved survival rates. These results indicate the potential of Mirzotamab Biosimilar as a targeted therapy for cancer.

2. Combination Therapy:

Mirzotamab Biosimilar has also shown potential as a combination therapy in cancer treatment. In a study on prostate cancer, it was found that the combination of Mirzotamab Biosimilar and another targeted therapy resulted in a more significant reduction in tumor growth compared to either therapy alone. This suggests that Mirzotamab Biosimilar can be used in combination with other therapies to enhance their efficacy.

3. Immunotherapy:

B7-H3 is known to suppress immune response against cancer cells, making them resistant to conventional therapies. By blocking the activity of B7-H3, Mirzotamab Biosimilar can restore immune response and sensitize cancer cells to other treatments. This makes it a potential candidate for immunotherapy in cancer treatment.

4. Research Grade Antibody:

Apart from its therapeutic applications, Mirzotamab Biosimilar can also be used as a research grade antibody for studying the role of B7-H3 in cancer. Its high specificity and affinity for B7-H3 make it a valuable tool for investigating the function of this protein in different types of cancer.

Conclusion:

Mirzotamab Biosimilar is a promising antibody for targeting B7-H3 in cancer therapy. Its unique structure, mechanism of action, and potential applications make it a valuable addition to the arsenal of cancer treatments. Further clinical studies are needed to establish its safety and efficacy in humans, but the preclinical data is highly promising. With its potential to improve cancer treatment outcomes, Mirzotamab Biosimilar has the potential to make a significant impact in the field of oncology.

Mirzotamab Biosimilar - Anti-CD276,B7-H3 mAb - Research Grade binds to CD276 Recombinant Protein in ELISA assay

Mirzotamab Biosimilar - Anti-CD276,B7-H3 mAb - Research Grade binds to CD276 Recombinant Protein in ELISA assay

Immobilized CD276 Recombinant Protein (cat. No.PX-P4125) at 0.5µg/mL (100µL/well) can bind Mirzotamab Biosimilar - Anti-CD276,B7-H3 mAb - Research Grade (cat. No.PX-TA1596) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 7.969M.

Flow Cytometry results for Mirzotamab Biosimilar - Anti-CD276;B7-H3 mAb - Research Grade

Flow Cytometry results for Mirzotamab Biosimilar - Anti-CD276;B7-H3 mAb - Research Grade

Flow-cytometry using APC anti-human CD276 antibody. PC-3 cells were stained with an irrelevant antibody (Blue Histogram) or an APC anti-human CD276 monoclonal antibody (Catalog: PX-TA1596, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, cells analysed on a NovoCyte Flow Cytometer.

Mirzotamab  Biosimilar - Anti-CD276, B7-H3 mAb - Research Grade

There are no reviews yet.

Be the first to review “Mirzotamab Biosimilar – Anti-CD276, B7-H3 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products