Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mirikizumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Mirikizumab ELISA Kit

Mirikizumab ELISA Kit

Product name Mirikizumab ELISA Kit
Uniprot ID Q9NPF7
Raw Antigen Sequence MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX276
Note For research use only.
Sample type Plasma, Serum
Target Mirikizumab
Immunogen Mirikizumab

Mirikizumab ELISA Kit: A Revolutionary Tool for Antibody Detection and Therapeutic Targeting The Mirikizumab ELISA Kit is a cutting-edge scientific tool designed for the detection and measurement of Mirikizumab, a humanized monoclonal antibody used as a therapeutic target for various diseases. This highly sensitive and specific ELISA kit is an essential tool for researchers and clinicians studying the structure, activity, and application of Mirikizumab.

Structure of Mirikizumab

Mirikizumab is a fully humanized IgG4 monoclonal antibody that specifically targets the interleukin-23 (IL-23) cytokine. It is composed of two heavy chains and two light chains, each containing variable and constant regions. The variable regions of Mirikizumab are responsible for its high specificity towards IL-23, while the constant regions determine its effector functions.

The structural characteristics of Mirikizumab make it a highly stable and potent therapeutic agent. It has a long half-life of approximately 21 days, allowing for less frequent dosing compared to other antibodies. Additionally, its humanized structure reduces the risk of immunogenicity, making it a safe and well-tolerated treatment option for patients.

Activity of Mirikizumab

The main activity of Mirikizumab is its ability to bind and neutralize IL-23, a key cytokine involved in the pathogenesis of various autoimmune and inflammatory diseases. By blocking IL-23, Mirikizumab inhibits the production of pro-inflammatory cytokines such as IL-17 and IL-22, which are responsible for tissue damage and disease progression.

Studies have shown that Mirikizumab is highly effective in treating diseases such as psoriasis, Crohn’s disease, and ulcerative colitis. It has also shown promising results in clinical trials for other autoimmune diseases such as rheumatoid arthritis and multiple sclerosis. Its mechanism of action makes it a promising therapeutic target for a wide range of diseases.

Application of Mirikizumab ELISA Kit

The Mirikizumab ELISA Kit is an essential tool for the detection and quantification of Mirikizumab in various biological samples. It utilizes a sandwich ELISA format, where Mirikizumab is captured by a specific anti-Mirikizumab antibody and detected by a secondary antibody conjugated to an enzyme. The resulting color change is then measured and correlated to the amount of Mirikizumab present in the sample.

This ELISA kit has a wide range of applications in both research and clinical settings. In research, it can be used to study the pharmacokinetics and pharmacodynamics of Mirikizumab, as well as its role in disease pathogenesis. In clinical settings, it can be used to monitor Mirikizumab levels in patients receiving treatment and to assess treatment response.

Conclusion

The Mirikizumab ELISA Kit is a state-of-the-art tool for the detection and measurement of Mirikizumab, a highly effective therapeutic antibody targeting IL-23. Its high sensitivity and specificity, along with its wide range of applications, make it an essential tool for researchers and clinicians studying the structure, activity, and application of Mirikizumab. With its potential to revolutionize the treatment of various diseases, the Mirikizumab ELISA Kit is a valuable addition to the scientific community.

Mirikizumab ELISA Kit

There are no reviews yet.

Be the first to review “Mirikizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products