Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Levilimab Biosimilar – Anti-IL6R mAb – Research Grade

  • PX-TA1545-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €172.00.Current price is: €140.00.

50ug 19% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Levilimab Biosimilar - Anti-IL6R mAb - Research Grade

Product name Levilimab Biosimilar - Anti-IL6R mAb - Research Grade
Uniprot ID P08887
Source CAS 2035008-70-7
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Levilimab ,BCD-089,IL6R,anti-IL6R
Reference PX-TA1545
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Levilimab Biosimilar - Anti-IL6R mAb - Research Grade
Uniprot ID P08887
Source CAS 2035008-70-7
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Levilimab ,BCD-089,IL6R,anti-IL6R
Reference PX-TA1545
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1545-50
Uniprot ID P08887
Source CAS 2035008-70-7
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Levilimab ,BCD-089,IL6R,anti-IL6R
Reference PX-TA1545
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Levilimab Biosimilar – Anti-IL6R mAb

Levilimab Biosimilar is a monoclonal antibody (mAb) that targets the interleukin-6 receptor (IL6R). It is a research grade antibody that has shown promising results in pre-clinical and clinical studies as a potential therapeutic for various inflammatory and autoimmune diseases. In this article, we will dive into the structure, activity, and potential applications of Levilimab Biosimilar.

Structure of Levilimab Biosimilar

Levilimab Biosimilar is a biosimilar version of the anti-IL6R mAb, tocilizumab. It is a fully humanized IgG1 kappa monoclonal antibody with a molecular weight of approximately 148 kDa. The antibody is composed of two heavy chains and two light chains, each containing a variable and constant region.

The variable region of Levilimab Biosimilar is responsible for its specificity and binding to IL6R. It recognizes and binds to the extracellular domain of IL6R, preventing the binding of interleukin-6 (IL-6) and subsequent signaling through the IL-6/IL6R complex. This inhibits the pro-inflammatory effects of IL-6, making Levilimab Biosimilar a potential therapeutic for IL-6 driven diseases.

Activity of Levilimab Biosimilar

The main activity of Levilimab Biosimilar is its ability to block the IL-6 signaling pathway. IL-6 is a cytokine that plays a crucial role in the immune response, inflammation, and tissue regeneration. However, dysregulation of IL-6 signaling has been linked to various diseases, including rheumatoid arthritis, systemic juvenile idiopathic arthritis, and cytokine release syndrome (CRS).

By binding to IL6R, Levilimab Biosimilar prevents the binding of IL-6 and inhibits its downstream signaling. This leads to a decrease in the production of pro-inflammatory cytokines and chemokines, as well as a reduction in the recruitment and activation of immune cells. Overall, Levilimab Biosimilar helps to restore the balance of the immune system and reduce inflammation.

Potential Applications of Levilimab Biosimilar

Levilimab Biosimilar has shown promising results in pre-clinical and clinical studies as a potential therapeutic for various inflammatory and autoimmune diseases. Some of the potential applications of Levilimab Biosimilar include:

Rheumatoid Arthritis (RA) RA is a chronic autoimmune disease characterized by inflammation of the joints, leading to pain and stiffness. IL-6 has been identified as a key player in the pathogenesis of RA. Levilimab Biosimilar has shown efficacy in reducing the signs and symptoms of RA in clinical trials, making it a potential treatment option for this disease.

Cytokine Release Syndrome (CRS)

CRS is a severe and potentially life-threatening complication that can occur in response to certain immunotherapies. It is characterized by an excessive release of pro-inflammatory cytokines, including IL-6. Levilimab Biosimilar has shown promising results in reducing the severity of CRS in pre-clinical studies, making it a potential treatment for this condition.

Systemic Juvenile Idiopathic Arthritis (SJIA)

SJIA is a rare form of juvenile idiopathic arthritis (JIA) that is characterized by systemic inflammation and high levels of IL-6. Levilimab Biosimilar has shown efficacy in reducing the symptoms of SJIA in clinical trials, making it a potential treatment option for this disease.

Other Inflammatory and Autoimmune Diseases

IL-6 has been implicated in the pathogenesis of various other inflammatory and autoimmune diseases, such as psoriasis, Crohn’s disease

Levilimab Biosimilar - Anti-CD126;IL6R mAb - Research Grade binds to CD126 Recombinant Protein in ELISA assay

Levilimab Biosimilar - Anti-CD126;IL6R mAb - Research Grade binds to CD126 Recombinant Protein in ELISA assay

Immobilized CD126 Recombinant Protein (cat. No.PX-P4104) at 0.5µg/mL (100µL/well) can bind Levilimab Biosimilar - Anti-CD126;IL6R mAb - Research Grade (cat. No.PX-TA1545) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 1.08M.

Levilimab  Biosimilar - Anti-IL6R mAb - Research Grade

There are no reviews yet.

Be the first to review “Levilimab Biosimilar – Anti-IL6R mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products