Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Satralizumab ELISA Kit

Assay type:
Quantitative, Competitive

750.00

96T + 750 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Satralizumab ELISA Kit

Satralizumab ELISA Kit

Product name Satralizumab ELISA Kit
Uniprot ID P08887
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stocks, 3-5 weeks if production is needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Aliases /Synonyms Sapelizumab, SA-237, SA237, satralizumab-mwg, CAS: 1535963-91-7
Note For research use only.
Target Satralizumab
Immunogen Satralizumab
Assay type Quantitative, Competitive

Introduction

Satralizumab is a humanized monoclonal antibody that targets the interleukin-6 (IL-6) receptor, making it a promising therapeutic target for various autoimmune and inflammatory diseases. The Satralizumab ELISA Kit is a highly sensitive and specific assay that allows for the quantification of Satralizumab levels in various biological samples. In this article, we will discuss the structure, activity, and application of the Satralizumab ELISA Kit in detail.

Structure of Satralizumab

Satralizumab is a recombinant humanized IgG2 monoclonal antibody that was developed using genetic engineering techniques. It consists of two heavy chains and two light chains, each with a molecular weight of approximately 50 kDa. The heavy chains are composed of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains contain one constant domain (CL) and one variable domain (VL). Satralizumab specifically targets the IL-6 receptor, which is expressed on the surface of various cells, including immune cells and endothelial cells.

Mechanism of Action

The IL-6 receptor plays a crucial role in the regulation of immune responses and inflammation. Satralizumab binds to the IL-6 receptor with high affinity, preventing IL-6 from binding and activating the receptor. This blocks the downstream signaling pathways that lead to inflammation, making Satralizumab an effective treatment for autoimmune and inflammatory diseases.

Application of Satralizumab ELISA Kit

The Satralizumab ELISA Kit is a powerful tool for monitoring Satralizumab levels in biological samples. It can be used in both preclinical and clinical studies to evaluate the pharmacokinetics and pharmacodynamics of Satralizumab. The kit is also useful for assessing the efficacy of Satralizumab treatment and determining the optimal dosage for individual patients.

Therapeutic Target

The primary therapeutic target of Satralizumab is neuromyelitis optica spectrum disorder (NMOSD), a rare autoimmune disease that affects the central nervous system. NMOSD is characterized by inflammation and damage to the optic nerves and spinal cord, leading to vision loss, paralysis, and other neurological symptoms. Satralizumab has been shown to significantly reduce the risk of relapse in patients with NMOSD and is now approved for use in this indication in several countries.

Research Use

In addition to its therapeutic use, Satralizumab is also being studied in various other autoimmune and inflammatory diseases, including rheumatoid arthritis, multiple sclerosis, and inflammatory bowel disease. The Satralizumab ELISA Kit is a valuable tool for researchers in these fields, allowing for the measurement of Satralizumab levels in different biological samples and the evaluation of its pharmacokinetics and pharmacodynamics in various disease states.

Conclusion

The Satralizumab ELISA Kit is a highly sensitive and specific assay that plays a crucial role in the development and use of Satralizumab as a therapeutic agent. Its ability to accurately measure Satralizumab levels in various biological samples makes it an essential tool for both preclinical and clinical studies. With its promising results in NMOSD and ongoing research in other autoimmune and inflammatory diseases, Satralizumab has the potential to significantly improve the lives of patients suffering from these conditions.

There are no reviews yet.

Be the first to review “Satralizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products