Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Lenvervimab Biosimilar – Anti-HBV mAb – Research Grade

  • PX-TA1509-50
  • Validated FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €193.00.Current price is: €140.00.

50ug 27% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Lenvervimab Biosimilar - Anti-HBV mAb - Research Grade

Product name Lenvervimab Biosimilar - Anti-HBV mAb - Research Grade
Uniprot ID P03142-3
Source CAS 2055006-79-4
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSKFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Lenvervimab,GC-1102 ,HBV,anti-HBV
Reference PX-TA1509
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Lenvervimab Biosimilar - Anti-HBV mAb - Research Grade
Uniprot ID P03142-3
Source CAS 2055006-79-4
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSKFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Lenvervimab,GC-1102 ,HBV,anti-HBV
Reference PX-TA1509
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1509-50
Uniprot ID P03142-3
Source CAS 2055006-79-4
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSKFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Lenvervimab,GC-1102 ,HBV,anti-HBV
Reference PX-TA1509
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Lenvervimab Biosimilar, also known as Anti-HBV mAb, is a monoclonal antibody that specifically targets the hepatitis B virus (HBV). This biosimilar is a research grade product that has been developed for the purpose of studying and understanding the structure and activity of HBV, as well as its potential as a therapeutic target. In this article, we will delve into the details of Lenvervimab Biosimilar, its structure, activity, and potential applications.

Structure of Lenvervimab Biosimilar

Lenvervimab Biosimilar is a monoclonal antibody, which means it is a laboratory-produced protein that is designed to mimic the natural antibodies produced by the human immune system. It is composed of two identical heavy chains and two identical light chains, held together by disulfide bonds. The heavy and light chains are made up of amino acid sequences that are specific to the targeting of HBV.

The structure of Lenvervimab Biosimilar is important because it determines its ability to bind to and neutralize the HBV virus. The heavy and light chains contain specific regions called variable regions, which are responsible for recognizing and binding to specific antigens on the surface of the virus. These variable regions are highly specific and unique to Lenvervimab Biosimilar, making it a potent and effective anti-HBV agent.

Activity of Lenvervimab Biosimilar

The main activity of Lenvervimab Biosimilar is to bind to the surface antigens of the HBV virus, preventing it from infecting liver cells. This binding also triggers the immune system to recognize and destroy the virus, ultimately leading to its clearance from the body.

Additionally, Lenvervimab Biosimilar has been shown to have a neutralizing effect on the HBV virus, meaning it can prevent the virus from replicating and spreading to other cells. This is a crucial activity as it not only helps in clearing the virus from the body, but also in preventing its recurrence.

Moreover, Lenvervimab Biosimilar has been found to have a long half-life, meaning it stays in the body for an extended period of time, providing sustained protection against HBV infection. This makes it a promising agent for potential therapeutic use.

Application of Lenvervimab Biosimilar

As a research grade product, Lenvervimab Biosimilar has various applications in the study of HBV. It can be used to understand the structure and function of the virus, as well as the mechanisms of action of the antibody itself. This can aid in the development of new and improved treatments for HBV infection.

Moreover, Lenvervimab Biosimilar can also be used in pre-clinical studies to assess its safety and efficacy as a potential therapeutic agent. Its high specificity and potency make it a promising candidate for the treatment of HBV infection, which affects millions of people worldwide.

Furthermore, Lenvervimab Biosimilar can also be used in diagnostic assays to detect and measure the levels of HBV in the body. This can aid in monitoring the progression of the disease and the effectiveness of treatment.

Conclusion

In conclusion, Lenvervimab Biosimilar is a research grade monoclonal antibody that specifically targets the HBV virus. Its unique structure and potent activity make it a valuable tool in the study of HBV and its potential as a therapeutic target. With further research and development, Lenvervimab Biosimilar has the potential to greatly impact the treatment and management of HBV infection.

Flow Cytometry results for Lenvervimab Biosimilar - Anti-HBV mAb - Research Grade

Flow Cytometry results for Lenvervimab Biosimilar - Anti-HBV mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Lenvervimab Biosimilar - Anti-HBV mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

SDS-PAGE for Lenvervimab Biosimilar - Anti-HBV mAb - Research Grade

SDS-PAGE for Lenvervimab Biosimilar - Anti-HBV mAb - Research Grade

Lenvervimab Biosimilar - Anti-HBV mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Lenvervimab Biosimilar - Anti-HBV mAb - Research Grade

There are no reviews yet.

Be the first to review “Lenvervimab Biosimilar – Anti-HBV mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products