Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Kelch-like ECH-associated protein 1(KEAP1)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q14145
Molecular weight:
18.07 kDa

Original price was: €233.00.Current price is: €210.00.

50ug 10% OFF + 210 loyalty points
His Ala90–IIe250
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Kelch-like ECH-associated protein 1(KEAP1)

Product name PX-P4789-1MG
Uniprot ID Q14145
Uniprot link https://www.uniprot.org/uniprot/Q14145
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence AAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLISRDDLNVRCESEVFHACI
Molecular weight 18.07 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala90-IIe250
Protein Accession Q14145
Spec:Entrez GeneID 9817
Spec:NCBI Gene Aliases INrf2; KLHL19
Spec:SwissProtID Q9BPY9
NCBI Reference Q14145
Aliases /Synonyms Cytosolic inhibitor of Nrf2; INrf2;Kelch-like protein 19
Reference PX-P4789
Note For research use only.
Molecular Constructor
His Ala90–IIe250
Product name Kelch-like ECH-associated protein 1(KEAP1)
Uniprot ID Q14145
Uniprot link https://www.uniprot.org/uniprot/Q14145
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence AAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVM YQIDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLIS RDDLNVRCESEVFHACI
Molecular weight 18.07 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala90-IIe250
Protein Accession Q14145
Spec:Entrez GeneID 9817
Spec:NCBI Gene Aliases INrf2; KLHL19
Spec:SwissProtID Q9BPY9
NCBI Reference Q14145
Aliases /Synonyms Cytosolic inhibitor of Nrf2; INrf2;Kelch-like protein 19
Reference PX-P4789
Note For research use only
Molecular Constructor
His Ala90–IIe250
Product name Kelch-like ECH-associated protein 1(KEAP1)
Uniprot ID Q14145
Uniprot link https://www.uniprot.org/uniprot/Q14145
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence AAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVM YQIDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLIS RDDLNVRCESEVFHACI
Molecular weight 18.07 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala90-IIe250
Protein Accession Q14145
Spec:Entrez GeneID 9817
Spec:NCBI Gene Aliases INrf2; KLHL19
Spec:SwissProtID Q9BPY9
NCBI Reference Q14145
Aliases /Synonyms Cytosolic inhibitor of Nrf2; INrf2;Kelch-like protein 19
Reference PX-P4789
Note For research use only
Molecular Constructor
His Ala90–IIe250

Kelch-like ECH-associated protein 1(KEAP1)

There are no reviews yet.

Be the first to review “Kelch-like ECH-associated protein 1(KEAP1)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products