Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

IFNB1 / IFN-beta, N-His, recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P01574
Molecular weight:
22.19 kDa

€329.00

100ug + 329 loyalty points
His Met22–Asn187
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for IFNB1 / IFN-beta, N-His, recombinant protein
IFNB1 / IFN-beta, N-His, recombinant protein

IFNB1 / IFN-beta, N-His, recombinant protein

Product name IFNB1 / IFN-beta, N-His, recombinant protein
Uniprot ID P01574
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Molecular weight 22.19 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met22-Asn187
Protein Accession P01574
Reference PX-P5769
Note For research use only
Molecular Constructor
His Met22–Asn187

SDS-PAGE for IFNB1 / IFN-beta, N-His, recombinant protein

SDS-PAGE for IFNB1 / IFN-beta, N-His, recombinant protein

IFNB1 / IFN-beta, N-His, recombinant protein on SDS-PAGE under reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is superior than 90 %.

IFNB1 / IFN-beta, N-His, recombinant protein

There are no reviews yet.

Be the first to review “IFNB1 / IFN-beta, N-His, recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products