Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Isocitrate dehydrogenase [NADP] cytoplasmic(IDH1)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
O75874
Molecular weight:
46.67 kDa

€142.00

100ug + 142 loyalty points
His Met1–Leu414
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Isocitrate dehydrogenase [NADP] cytoplasmic(IDH1)

Isocitrate dehydrogenase [NADP] cytoplasmic(IDH1)

Product name Isocitrate dehydrogenase [NADP] cytoplasmic(IDH1)
Uniprot ID O75874
Uniprot link https://www.uniprot.org/uniprot/O75874
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVK CATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDF VVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTIL KKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSL GMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALE EVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL*
Molecular weight 46.67 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu414
Protein Accession O75874
Spec:Entrez GeneID 3417
Spec:NCBI Gene Aliases IDH; IDP; IDCD; IDPC; PICD; HEL-216; HEL-S-26
Spec:SwissProtID Q567U4
NCBI Reference O75874
Aliases /Synonyms IDH，Cytosolic NADP-isocitrate dehydrogenase，IDP，NADP(+)-specific ICDH，Oxalosuccinate decarboxylase
Reference PX-P4779
Note For research use only
Molecular Constructor
His Met1–Leu414
Product name Isocitrate dehydrogenase [NADP] cytoplasmic(IDH1)
Uniprot ID O75874
Uniprot link https://www.uniprot.org/uniprot/O75874
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVK CATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDF VVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTIL KKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSL GMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALE EVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL*
Molecular weight 46.67 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu414
Protein Accession O75874
Spec:Entrez GeneID 3417
Spec:NCBI Gene Aliases IDH; IDP; IDCD; IDPC; PICD; HEL-216; HEL-S-26
Spec:SwissProtID Q567U4
NCBI Reference O75874
Aliases /Synonyms IDH，Cytosolic NADP-isocitrate dehydrogenase，IDP，NADP(+)-specific ICDH，Oxalosuccinate decarboxylase
Reference PX-P4779
Note For research use only
Molecular Constructor
His Met1–Leu414

There are no reviews yet.

Be the first to review “Isocitrate dehydrogenase [NADP] cytoplasmic(IDH1)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products