Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

InVivoMAb Anti-Human CD79b & CD3 Bispecific Antibody (BS001)

  • ARO-A13043-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody

Original price was: €466.00.Current price is: €333.00.

50ug 29% OFF + 333 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

InVivoMAb Anti-Human CD79b & CD3 Bispecific Antibody (BS001)

Product name ARO-A13043-100
Uniprot ID P40259 & P07766
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Aliases /Synonyms Anti-B-cell-specific glycoprotein B29, CD79B, B-cell antigen receptor complex-associated protein beta chain, Ig-beta, B29, Immunoglobulin-associated B29 protein, IGB, CD79b, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference ARO-A13043
Clonality Monoclonal Antibody
Protein Name B-cell-specific glycoprotein B29
Product name ARO-A13043-1MG
Uniprot ID P40259 & P07766
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Aliases /Synonyms Anti-B-cell-specific glycoprotein B29, CD79B, B-cell antigen receptor complex-associated protein beta chain, Ig-beta, B29, Immunoglobulin-associated B29 protein, IGB, CD79b, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference ARO-A13043
Clonality Monoclonal Antibody
Protein Name B-cell-specific glycoprotein B29
Product name ARO-A13043-50
Uniprot ID P40259 & P07766
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Aliases /Synonyms Anti-B-cell-specific glycoprotein B29, CD79B, B-cell antigen receptor complex-associated protein beta chain, Ig-beta, B29, Immunoglobulin-associated B29 protein, IGB, CD79b, T3E, T-cell surface antigen T3/Leu-4 epsilon chain, CD3e, CD3E, T-cell surface glycoprotein CD3 epsilon chain
Reference ARO-A13043
Clonality Monoclonal Antibody
Protein Name B-cell-specific glycoprotein B29

InVivoMAb Anti-Human CD79b & CD3 Bispecific Antibody (BS001) in ELISA Assay

InVivoMAb Anti-Human CD79b & CD3 Bispecific Antibody (BS001) in ELISA Assay

InVivoMAb Anti-Human CD79b & CD3 Bispecific Antibody (BS001) can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for InVivoMAb Anti-Human CD79b & CD3 Bispecific Antibody (BS001)

SDS-PAGE for InVivoMAb Anti-Human CD79b & CD3 Bispecific Antibody (BS001)

InVivoMAb Anti-Human CD79b & CD3 Bispecific Antibody (BS001), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Human CD79b & CD3 Bispecific Antibody (BS001)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products