Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Infliximab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Infliximab ELISA Kit

Infliximab ELISA Kit

Product name Infliximab ELISA Kit
Uniprot ID P01375
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX130
Note For research use only.
Sample type Plasma, Serum
Target Infliximab
Immunogen Infliximab

Introduction to Infliximab ELISA Kit

Infliximab is a monoclonal antibody that is used as a therapeutic agent for various inflammatory diseases such as rheumatoid arthritis, Crohn’s disease, and ulcerative colitis. It works by targeting and neutralizing tumor necrosis factor-alpha (TNF-α), a pro-inflammatory cytokine that plays a key role in these diseases. The Infliximab ELISA Kit is a reliable and sensitive tool for measuring the levels of Infliximab in biological samples, allowing for accurate monitoring of therapy and drug efficacy.

Structure of Infliximab

Infliximab is a chimeric monoclonal antibody, meaning it is composed of both human and mouse components. It consists of two heavy chains and two light chains, with a molecular weight of approximately 149 kDa. The heavy chains are composed of four constant regions (CH1, CH2, CH3, and CH4) and one variable region (VH), while the light chains have one constant region (CL) and one variable region (VL). The variable regions are responsible for binding to the target molecule, TNF-α, while the constant regions provide stability and effector functions.

Activity of Infliximab

Infliximab works by binding to TNF-α and preventing it from interacting with its receptors on immune cells. This blocks the downstream signaling pathways that lead to inflammation and tissue damage. In addition, Infliximab can also induce apoptosis (cell death) of TNF-α-producing cells, further reducing the levels of this pro-inflammatory cytokine. This dual mechanism of action makes Infliximab a potent and effective therapeutic agent for various inflammatory diseases.

Application of Infliximab ELISA Kit

The Infliximab ELISA Kit is a valuable tool for monitoring Infliximab levels in patients undergoing therapy. It can be used to measure the drug levels in serum, plasma, or other biological samples, providing important information on drug absorption, distribution, and elimination. This allows clinicians to adjust the dosage and frequency of Infliximab administration to achieve optimal therapeutic outcomes.

In addition, the Infliximab ELISA Kit can also be used for pharmacokinetic studies, where drug levels are measured at different time points to determine the drug’s half-life and clearance rate. This information is crucial for understanding the drug’s behavior in the body and predicting its efficacy and safety in different patient populations.

Furthermore, the Infliximab ELISA Kit can also be used for research purposes, such as studying the pharmacodynamics of Infliximab and its effects on TNF-α levels in different disease models. It can also be used to compare the levels of Infliximab in patients with different disease severities and treatment responses, providing insights into the drug’s efficacy and potential biomarkers for monitoring therapy.

Conclusion

The Infliximab ELISA Kit is a valuable tool for accurately measuring Infliximab levels in biological samples. Its high sensitivity and specificity make it a reliable method for monitoring therapy and studying the pharmacokinetics and pharmacodynamics of Infliximab. With the increasing use of Infliximab as a therapeutic agent, the Infliximab ELISA Kit will continue to play an important role in improving patient outcomes and advancing research in the field of inflammatory diseases.

Infliximab ELISA Kit

There are no reviews yet.

Be the first to review “Infliximab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products