Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ianalumab Biosimilar – Anti-TNFRSF13C, CD268 mAb – Research Grade

  • PX-TA1480-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €169.00.Current price is: €140.00.

50ug 17% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Ianalumab Biosimilar - Anti-TNFRSF13C, CD268 mAb - Research Grade

Product name Ianalumab Biosimilar - Anti-TNFRSF13C, CD268 mAb - Research Grade
Uniprot ID Q96RJ3
Source CAS 1929549-92-7
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Ianalumab,VAY-736,TNFRSF13C, CD268,anti-TNFRSF13C, CD268
Reference PX-TA1480
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Ianalumab Biosimilar - Anti-TNFRSF13C, CD268 mAb - Research Grade
Uniprot ID Q96RJ3
Source CAS 1929549-92-7
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Ianalumab,VAY-736,TNFRSF13C, CD268,anti-TNFRSF13C, CD268
Reference PX-TA1480
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1480-50
Uniprot ID Q96RJ3
Source CAS 1929549-92-7
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Ianalumab,VAY-736,TNFRSF13C, CD268,anti-TNFRSF13C, CD268
Reference PX-TA1480
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Ianalumab Biosimilar, also known as Anti-TNFRSF13C or CD268 monoclonal antibody, is a research grade therapeutic antibody that has been developed as a biosimilar to the existing drug, Belimumab. This antibody targets the TNFRSF13C protein, also known as CD268, which plays a crucial role in the regulation of the immune system. In this article, we will discuss the structure, activity, and potential applications of Ianalumab Biosimilar.

Structure of Ianalumab Biosimilar

Ianalumab Biosimilar is a monoclonal antibody, which means it is produced from a single type of immune cell. It is a fully humanized antibody, meaning it is derived from human cells and therefore has a lower risk of causing an immune response in patients. The antibody has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains, held together by disulfide bonds.

The variable regions of the antibody, which are responsible for binding to the target protein, are highly specific for the TNFRSF13C protein. This specificity is achieved through the process of genetic engineering, where the antibody is produced by inserting the gene for the variable region into a host cell.

Activity of Ianalumab Biosimilar

The primary function of Ianalumab Biosimilar is to bind to the TNFRSF13C protein, which is found on the surface of immune cells called B cells. This binding prevents the TNFRSF13C protein from interacting with its natural ligands, BAFF and APRIL, which are essential for the survival and proliferation of B cells.

By inhibiting the activity of TNFRSF13C, Ianalumab Biosimilar reduces the number of B cells in the body, which can be beneficial in autoimmune diseases where there is an overactive immune response. Additionally, the antibody may also modulate the production of antibodies by B cells, further regulating the immune response.

Application of Ianalumab Biosimilar

Ianalumab Biosimilar has the potential to be used in the treatment of various autoimmune diseases, including systemic lupus erythematosus (SLE), rheumatoid arthritis, and Sjogren’s syndrome. These diseases are characterized by an overactive immune response, and the targeting of TNFRSF13C with Ianalumab Biosimilar can help to regulate this response and reduce the symptoms of the disease.

In addition to its potential therapeutic applications, Ianalumab Biosimilar can also be used as a research tool in the study of B cell biology and the immune system. The specificity of the antibody for TNFRSF13C makes it a valuable tool for studying the role of this protein in various diseases and in normal immune function.

Conclusion

In summary, Ianalumab Biosimilar is a fully humanized monoclonal antibody that targets the TNFRSF13C protein. Its specific binding to this protein allows for the modulation of the immune response, making it a potential treatment option for autoimmune diseases. Additionally, the antibody can also be used as a research tool in the study of B cell biology. With its promising therapeutic and research applications, Ianalumab Biosimilar has the potential to make a significant impact in the field of immunology.

SDS-PAGE for Ianalumab Biosimilar - Anti-CD268,TNFRSF13C mAb - Research Grade

SDS-PAGE for Ianalumab Biosimilar - Anti-CD268,TNFRSF13C mAb - Research Grade

Ianalumab Biosimilar - Anti-CD268,TNFRSF13C mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Flow Cytometry results for Ianalumab Biosimilar - Anti-CD268;TNFRSF13C mAb - Research Grade

Flow Cytometry results for Ianalumab Biosimilar - Anti-CD268;TNFRSF13C mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Ianalumab Biosimilar - Anti-CD268;TNFRSF13C mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Ianalumab Biosimilar - Anti-TNFRSF13C, CD268 mAb - Research Grade

There are no reviews yet.

Be the first to review “Ianalumab Biosimilar – Anti-TNFRSF13C, CD268 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products