Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD268-TNFRSF13C recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q96RJ3
Molecular weight:
35.79 kDa

€420.00

100ug + 420 loyalty points
Arg2–Ala71 Fc
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD268-TNFRSF13C recombinant protein

Product name Human CD268-TNFRSF13C recombinant protein
Uniprot ID Q96RJ3
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence RRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAA
Molecular weight 35.79 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Arg2-Ala71
Aliases /Synonyms BR3, TNFRSF13C, BAFF receptor, BLyS receptor 3, Tumor necrosis factor receptor superfamily member 13C, CD268, B-cell-activating factor receptor, BAFFR, BAFF-R, Drug Target
Reference PX-P6109
Note For research use only
Molecular Constructor
Arg2–Ala71 Fc

Human CD268-TNFRSF13C recombinant protein

There are no reviews yet.

Be the first to review “Human CD268-TNFRSF13C recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products