Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ianalumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Ianalumab ELISA Kit

Ianalumab ELISA Kit

Product name Ianalumab ELISA Kit
Uniprot ID Q96RJ3
Raw Antigen Sequence MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX273
Note For research use only.
Sample type Plasma, Serum
Target Ianalumab
Immunogen Ianalumab

The Structure of Ianalumab ELISA Kit

The Ianalumab ELISA Kit is a specialized tool used for the detection and quantification of Ianalumab, a monoclonal antibody that targets the protein interleukin-6 (IL-6). This kit is designed for use in scientific research and clinical applications, and it is based on the enzyme-linked immunosorbent assay (ELISA) technique.

The kit contains all the necessary components to perform the ELISA, including pre-coated microplates, standards, controls, and detection reagents. The microplates are coated with a capture antibody specific for Ianalumab, which allows for the specific binding of the antibody in the sample.

The Activity of Ianalumab ELISA Kit

The activity of the Ianalumab ELISA Kit is based on the principle of sandwich ELISA. In this technique, the pre-coated microplate captures the Ianalumab present in the sample. The detection reagent, which is a biotinylated detection antibody, is then added and binds to the captured Ianalumab. This forms a sandwich complex, with the Ianalumab sandwiched between the capture and detection antibodies.

Next, a streptavidin-HRP conjugate is added, which binds to the biotinylated detection antibody. This complex is then visualized by adding a substrate solution, which produces a color change in the presence of the streptavidin-HRP conjugate. The intensity of the color is directly proportional to the amount of Ianalumab present in the sample.

The Application of Ianalumab ELISA Kit

The Ianalumab ELISA Kit has a wide range of applications in scientific research and clinical settings. One of the main applications of this kit is the quantification of Ianalumab levels in biological samples. This is particularly useful in clinical trials and studies that involve the use of Ianalumab as a therapeutic agent.

In addition, the kit can also be used to measure the presence of Ianalumab in cell culture supernatants, serum, plasma, and other biological fluids. This allows for the monitoring of Ianalumab levels in different biological samples, which can provide valuable insights into the pharmacokinetics and pharmacodynamics of this therapeutic antibody.

Furthermore, the Ianalumab ELISA Kit can also be used to study the expression and regulation of IL-6 in different disease states. IL-6 is a pro-inflammatory cytokine that is involved in various physiological and pathological processes. By measuring the levels of Ianalumab, which specifically targets IL-6, researchers can gain a better understanding of the role of IL-6 in different diseases and potentially develop new therapeutic strategies.

Conclusion

In summary, the Ianalumab ELISA Kit is a highly sensitive and specific tool for the detection and quantification of Ianalumab in biological samples. Its unique design, based on the sandwich ELISA technique, allows for the accurate measurement of Ianalumab levels, making it an essential tool for research and clinical applications. By providing a detailed analysis of the structure, activity, and application of this kit, we hope to have shed light on the importance of this tool in the field of scientific research.

Ianalumab ELISA Kit

There are no reviews yet.

Be the first to review “Ianalumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products