Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Humanized HLA-G-0104 Biosimilar – Anti-HLA-G mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1

Original price was: €326.00.Current price is: €259.00.

50ug 21% OFF + 259 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Humanized HLA-G-0104 Biosimilar - Anti-HLA-G mAb - Research Grade

Product name Humanized HLA-G-0104 Biosimilar - Anti-HLA-G mAb - Research Grade
Uniprot ID P17693
Source HLA-G-0104, HLA-G-0031
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-HLA-G,HLAG,sHLA-G,HLA G antigen,MHC class I antigen G,HLA-6.0,HLA class I histocompatibility antigen,alpha chain G,HLA-G-0031,HLA-G-0104, HLA-G-0031
Reference PX-TA1895
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody
Product name Humanized HLA-G-0104 Biosimilar - Anti-HLA-G mAb - Research Grade
Uniprot ID P17693
Source HLA-G-0104, HLA-G-0031
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-HLA-G,HLAG,sHLA-G,HLA G antigen,MHC class I antigen G,HLA-6.0,HLA class I histocompatibility antigen,alpha chain G,HLA-G-0031,HLA-G-0104, HLA-G-0031
Reference PX-TA1895
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody
Product name PX-TA1895-50
Uniprot ID P17693
Source HLA-G-0104, HLA-G-0031
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-HLA-G,HLAG,sHLA-G,HLA G antigen,MHC class I antigen G,HLA-6.0,HLA class I histocompatibility antigen,alpha chain G,HLA-G-0031,HLA-G-0104, HLA-G-0031
Reference PX-TA1895
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody

Introduction

Humanized HLA-G-0104 Biosimilar, also known as Anti-HLA-G mAb, is a research grade antibody that has been developed to target the human leukocyte antigen-G (HLA-G) protein. This biosimilar is a promising therapeutic option for various diseases due to its unique structure, activity, and potential applications.

Structure

The HLA-G protein is a non-classical major histocompatibility complex (MHC) class I molecule that is primarily expressed on the surface of immune cells and plays a crucial role in immune tolerance. The Humanized HLA-G-0104 Biosimilar is a monoclonal antibody (mAb) that has been engineered to mimic the binding site of the natural HLA-G protein and has a similar structure to other humanized antibodies. It consists of two heavy chains and two light chains, each with a variable region that specifically recognizes and binds to the HLA-G protein.

Activity

The main function of Humanized HLA-G-0104 Biosimilar is to block the interaction between HLA-G and its receptors, thereby inhibiting the immune response. HLA-G is known to interact with various immune cells, including T cells, B cells, and natural killer cells, and its overexpression has been linked to immune escape in cancer cells. By targeting HLA-G, this biosimilar can modulate the immune response and potentially enhance the body’s ability to fight against cancer and other diseases.

Application in Cancer

One of the most promising applications of Humanized HLA-G-0104 Biosimilar is in cancer treatment. Studies have shown that HLA-G is overexpressed in various types of cancer, and its interaction with immune cells can promote tumor growth and metastasis. By targeting HLA-G, this biosimilar can potentially inhibit these processes and improve the response to cancer therapy. Furthermore, it has been shown to enhance the cytotoxicity of natural killer cells against cancer cells, making it a potential adjuvant therapy for cancer treatment.

Application in Transplantation

Another potential application of Humanized HLA-G-0104 Biosimilar is in organ transplantation. HLA-G is known to play a crucial role in immune tolerance and is expressed on the surface of donor organs. By targeting HLA-G, this biosimilar can potentially improve the success rate of organ transplantation by preventing rejection and reducing the need for immunosuppressive drugs. Additionally, it has been shown to have a protective effect on transplanted organs by reducing inflammation and promoting tissue repair.

Application in Autoimmune Diseases

HLA-G has also been implicated in various autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis. By targeting HLA-G, Humanized HLA-G-0104 Biosimilar can potentially modulate the immune response and reduce inflammation, thereby providing a novel treatment option for these diseases. Furthermore, it has been shown to have a synergistic effect when combined with other immunomodulatory drugs, making it a promising candidate for combination therapy in autoimmune diseases.

Conclusion

In summary, Humanized HLA-G-0104 Biosimilar is a research grade antibody that has been designed to target the HLA-G protein and modulate the immune response. Its unique structure and activity make it a promising therapeutic option for various diseases, including cancer, transplantation, and autoimmune diseases. Further research and clinical trials are needed to fully explore the potential of this biosimilar, but it has the potential to significantly improve patient outcomes and provide a new approach to treating these diseases.

SDS-PAGE for Humanized HLA-G-0104 Biosimilar - Anti-HLA-G mAb - Research Grade

SDS-PAGE for Humanized HLA-G-0104 Biosimilar - Anti-HLA-G mAb - Research Grade

Humanized HLA-G-0104 Biosimilar - Anti-HLA-G mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Humanized HLA-G-0104 Biosimilar - Anti-HLA-G mAb - Research Grade

There are no reviews yet.

Be the first to review “Humanized HLA-G-0104 Biosimilar – Anti-HLA-G mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products