Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human TACSTD2/TROP2 (TP15-4) Monoclonal Antibody

Original price was: €323.00.Current price is: €231.00.

50ug 28% OFF + 231 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human TACSTD2/TROP2 (TP15-4) Monoclonal Antibody

Product name ARO-A16169-100
Uniprot ID P09758
Uniprot link P09758
Raw Antigen Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Pancreatic carcinoma marker protein GA733-1, Tumor-associated calcium signal transducer 2, M1S1, TROP2, TACSTD2, Cell surface glycoprotein Trop-2, GA733-1, Membrane component chromosome 1 surface marker 1
Reference ARO-A16169
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TACSTD2/TROP2 (TP15-4)
Clone Name TP15-4
Protein Name TACSTD2/TROP2 (TP15-4)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16169-1MG
Uniprot ID P09758
Uniprot link P09758
Raw Antigen Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Pancreatic carcinoma marker protein GA733-1, Tumor-associated calcium signal transducer 2, M1S1, TROP2, TACSTD2, Cell surface glycoprotein Trop-2, GA733-1, Membrane component chromosome 1 surface marker 1
Reference ARO-A16169
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TACSTD2/TROP2 (TP15-4)
Clone Name TP15-4
Protein Name TACSTD2/TROP2 (TP15-4)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16169-50
Uniprot ID P09758
Uniprot link P09758
Raw Antigen Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Pancreatic carcinoma marker protein GA733-1, Tumor-associated calcium signal transducer 2, M1S1, TROP2, TACSTD2, Cell surface glycoprotein Trop-2, GA733-1, Membrane component chromosome 1 surface marker 1
Reference ARO-A16169
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen TACSTD2/TROP2 (TP15-4)
Clone Name TP15-4
Protein Name TACSTD2/TROP2 (TP15-4)
Target species Anti-Human Monoclonal Antibody

SDS-PAGE for Human TACSTD2/TROP2 (TP15-4) Monoclonal Antibody

SDS-PAGE for Human TACSTD2/TROP2 (TP15-4) Monoclonal Antibody

Human TACSTD2/TROP2 (TP15-4) Monoclonal Antibody, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Human TACSTD2/TROP2 (TP15-4) Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human TACSTD2/TROP2 (TP15-4) Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products