Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human SOST recombinant protein

  • PX-P6275
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9BQB4
Molecular weight:
24.03 kDa

420.00

100ug + 420 loyalty points
Gln24–Tyr213 His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human SOST recombinant protein

Product name Human SOST recombinant protein
Uniprot ID Q9BQB4
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence GQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENA
Molecular weight 24.03 kDa
Protein delivered with Tag? C-Terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gln24-Tyr213
Aliases /Synonyms Sclerostin
Reference PX-P6275
Note For research use only
Molecular Constructor
Gln24–Tyr213 His

Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb binds to Human SOST recombinant protein in indirect ELISA Assay

Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb binds to Human SOST recombinant protein in indirect ELISA Assay

Immobilized Human SOST recombinant protein (cat. No.PX-P6275) at 0.5µg/mL (100µL/well) can bind to Blosozumab Biosimilar - Anti-SOST(sclerostin) mAb (cat. No.PX-TA1267) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Romosozumab Biosimilar - Anti-SOST mAb binds to Human SOST recombinant protein in Indirect ELISA Assay

Romosozumab Biosimilar - Anti-SOST mAb binds to Human SOST recombinant protein in Indirect ELISA Assay

Immobilized Human SOST recombinant protein (cat. No.PX-P6275) at 0.5µg/mL (100µL/well) can bind to Romosozumab Biosimilar - Anti-SOST mAb (cat. No.PX-TA1281) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Human SOST recombinant protein

There are no reviews yet.

Be the first to review “Human SOST recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products