Name: Human Sex hormone-binding globulin (SHBG) Recombinant Protein
SKU: PX-P3004-10
Availability: InStock

Product name	Human Sex hormone-binding globulin (SHBG) Recombinant Protein
Uniprot ID	P04278
Uniprot link	http://www.uniprot.org/uniprot/P04278
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASHGSHHHHHH
Molecular weight	44.82 kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	PBS, pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Applications	ELISA,WB
Fragment Type	Full-length
NCBI Reference	P04278
Aliases /Synonyms	ABP, TEBG, SBP, Sex steroid-binding protein, Testis-specific androgen-binding protein, Testosterone-estradiol-binding globulin, Testosterone-estrogen-binding globulin,Sex Hormone Binding Globulin, SHBG
Reference	PX-P3004
Note	For research use only

No Products found