Name: Human WAP four-disulfide core domain protein 2(HE4) Recombinant Protein
SKU: PX-P3010-10
Availability: InStock

Product name	Human WAP four-disulfide core domain protein 2(HE4) Recombinant Protein
Uniprot ID	Q14508
Uniprot link	http://www.uniprot.org/uniprot/Q14508
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNFGSHHHHHH
Molecular weight	13.96 kDa
Protein delivered with Tag?	Yes
Purity estimated	95%
Buffer	PBS, pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Applications	ELISA,WB
Fragment Type	Full-length
NCBI Reference	Q14508
Aliases /Synonyms	WFDC2, HE4, WAP5, EDDM4, Epididymal Protein 4, Epididymal Secretory Protein E4, Putative Protease Inhibitor WAP5, Major epididymis-specific protein E4
Reference	PX-P3010
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human WAP four-disulfide core domain protein 2(HE4) Recombinant Protein”

size

Clear

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Human WAP four-disulfide core domain protein 2(HE4) Recombinant Protein