Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Human RNAse l Mutant type Recombinant Protein |
---|---|
Uniprot ID | P07998 |
Uniprot link | http://www.uniprot.org/uniprot/P07998 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | MGKESRAKKFQRQVMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDSTLEHHHHHH |
Molecular weight | 15.75 kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 90% |
Buffer | PBS, pH 7.5 |
Form | Frozen |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Partial |
Protein Accession | NP_002924 |
Spec:Entrez GeneID | 6035 |
Spec:NCBI Gene Aliases | RIB1, RNS1, RAC1 |
Spec:SwissProtID | P07998 |
NCBI Reference | NP_002924 |
Aliases /Synonyms | RNAse l Mutant type, ribonuclease, RNase A family, 1 (pancreatic) |
Reference | PX-P2089 |
Note | For research use only |
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.