Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Phenylalanine-4-hydroxylase(PAH)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P00439
Molecular weight:
37.49 kDa

Original price was: €220.00.Current price is: €183.00.

50ug 17% OFF + 183 loyalty points
Gly103–Thr427 N terminus His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Phenylalanine-4-hydroxylase(PAH)

Product name Phenylalanine-4-hydroxylase(PAH)
Uniprot ID P00439
Uniprot link https://www.uniprot.org/uniprot/P00439
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNT
Molecular weight 37.49 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly103-Thr427
Protein Accession P00439
Spec:Entrez GeneID 5053
Spec:NCBI Gene Aliases PH; PKU; PKU1
Spec:SwissProtID Q8TC14
NCBI Reference P00439
Aliases /Synonyms Phe-4-monooxygenase
Reference PX-P4804
Note For research use only
Molecular Constructor
Gly103–Thr427 N terminus His
Product name Phenylalanine-4-hydroxylase(PAH)
Uniprot ID P00439
Uniprot link https://www.uniprot.org/uniprot/P00439
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNT
Molecular weight 37.49 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly103-Thr427
Protein Accession P00439
Spec:Entrez GeneID 5053
Spec:NCBI Gene Aliases PH; PKU; PKU1
Spec:SwissProtID Q8TC14
NCBI Reference P00439
Aliases /Synonyms Phe-4-monooxygenase
Reference PX-P4804
Note For research use only
Molecular Constructor
Gly103–Thr427 N terminus His
Product name PX-P4804-1MG
Uniprot ID P00439
Uniprot link https://www.uniprot.org/uniprot/P00439
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNT
Molecular weight 37.49 kDa
Protein delivered with Tag? N terminus His tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly103-Thr427
Protein Accession P00439
Spec:Entrez GeneID 5053
Spec:NCBI Gene Aliases PH; PKU; PKU1
Spec:SwissProtID Q8TC14
NCBI Reference P00439
Aliases /Synonyms Phe-4-monooxygenase
Reference PX-P4804
Note For research use only
Molecular Constructor
Gly103–Thr427 N terminus His

Phenylalanine-4-hydroxylase(PAH)

There are no reviews yet.

Be the first to review “Phenylalanine-4-hydroxylase(PAH)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products