Brand: ProteoGenix

Phenylalanine-4-hydroxylase(PAH)

PX-P4804-50
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Homo sapiens (Human)
Uniprot ID:: P00439
Molecular weight:: 37.49 kDa

Original price was: €220.00.Current price is: €183.00.

50ug 17% OFF + 183 loyalty points

Gly103–Thr427 N terminus His

Size Size

50ug Original price was: €220.00.Current price is: €183.00.
100ug Original price was: €324.00.Current price is: €270.00.
1MG Original price was: €1,656.00.Current price is: €1,415.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Phenylalanine-4-hydroxylase(PAH)

Product name	Phenylalanine-4-hydroxylase(PAH)
Uniprot ID	P00439
Uniprot link	https://www.uniprot.org/uniprot/P00439
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	GATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNT
Molecular weight	37.49 kDa
Protein delivered with Tag?	N terminus His tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS pH 7.5, 0.02% SKL
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Gly103-Thr427
Protein Accession	P00439
Spec:Entrez GeneID	5053
Spec:NCBI Gene Aliases	PH; PKU; PKU1
Spec:SwissProtID	Q8TC14
NCBI Reference	P00439
Aliases /Synonyms	Phe-4-monooxygenase
Reference	PX-P4804
Note	For research use only
Molecular Constructor	Gly103–Thr427 N terminus His

Product name	Phenylalanine-4-hydroxylase(PAH)
Uniprot ID	P00439
Uniprot link	https://www.uniprot.org/uniprot/P00439
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	GATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNT
Molecular weight	37.49 kDa
Protein delivered with Tag?	N terminus His tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS pH 7.5, 0.02% SKL
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Gly103-Thr427
Protein Accession	P00439
Spec:Entrez GeneID	5053
Spec:NCBI Gene Aliases	PH; PKU; PKU1
Spec:SwissProtID	Q8TC14
NCBI Reference	P00439
Aliases /Synonyms	Phe-4-monooxygenase
Reference	PX-P4804
Note	For research use only
Molecular Constructor	Gly103–Thr427 N terminus His

Product name	PX-P4804-1MG
Uniprot ID	P00439
Uniprot link	https://www.uniprot.org/uniprot/P00439
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	GATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNT
Molecular weight	37.49 kDa
Protein delivered with Tag?	N terminus His tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS pH 7.5, 0.02% SKL
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Gly103-Thr427
Protein Accession	P00439
Spec:Entrez GeneID	5053
Spec:NCBI Gene Aliases	PH; PKU; PKU1
Spec:SwissProtID	Q8TC14
NCBI Reference	P00439
Aliases /Synonyms	Phe-4-monooxygenase
Reference	PX-P4804
Note	For research use only
Molecular Constructor	Gly103–Thr427 N terminus His