Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Human FGF1 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P05230
Molecular weight:
18.78 kDa

€210.00

+ 210 loyalty points
Full-length Yes
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Human ErbB2 Recombinant Protein

Human FGF1 Recombinant Protein

Product name Human FGF1 Recombinant Protein
Uniprot ID P05230
Uniprot link http://www.uniprot.org/uniprot/P05230
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MEMAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSDLEHHHHHH
Molecular weight 18.78 kDa
Protein delivered with Tag? Yes
Purity estimated 85%
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
NCBI Reference P05230
Aliases /Synonyms ECGF, AFGF, ECGFA, ECGFB, FGF-Alpha, FGFA, HBGF1, ECGFB, HBGF1, Acidic Fibroblast Growth Factor proteins, heparin-binding Growth Factor proteins 1, Endothelial Cell Growth Factor proteins, Beta
Reference PX-P3028
Note For research use only
Molecular Constructor
Full-length Yes
Product name Human FGF1 Recombinant Protein
Uniprot ID P05230
Uniprot link http://www.uniprot.org/uniprot/P05230
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MEMAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSDLEHHHHHH
Molecular weight 18.78 kDa
Protein delivered with Tag? Yes
Purity estimated 85%
Buffer PBS,pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
NCBI Reference P05230
Aliases /Synonyms ECGF, AFGF, ECGFA, ECGFB, FGF-Alpha, FGFA, HBGF1, ECGFB, HBGF1, Acidic Fibroblast Growth Factor proteins, heparin-binding Growth Factor proteins 1, Endothelial Cell Growth Factor proteins, Beta
Reference PX-P3028
Note For research use only
Molecular Constructor
Full-length Yes

SDS-PAGE for Human ErbB2 Recombinant Protein

SDS-PAGE for Human ErbB2 Recombinant Protein

Human ErbB2 Recombinant Protein, on SDS-PAGE under reducing

There are no reviews yet.

Be the first to review “Human FGF1 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products