Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CLEC5A/MDL1 Monoclonal Antibody

Original price was: €321.00.Current price is: €231.00.

50ug 28% OFF + 231 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CLEC5A/MDL1 Monoclonal Antibody

Product name ARO-A16094-100
Uniprot ID Q9NY25
Uniprot link Q9NY25
Raw Antigen Sequence MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms C-type lectin superfamily member 5, C-type lectin domain family 5 member A, CLEC5A, MDL-1, CLECSF5, MDL1, Myeloid DAP12-associating lectin 1
Reference ARO-A16094
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CLEC5A/MDL1
Clone Name DX246
Protein Name CLEC5A/MDL1
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16094-1MG
Uniprot ID Q9NY25
Uniprot link Q9NY25
Raw Antigen Sequence MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms C-type lectin superfamily member 5, C-type lectin domain family 5 member A, CLEC5A, MDL-1, CLECSF5, MDL1, Myeloid DAP12-associating lectin 1
Reference ARO-A16094
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CLEC5A/MDL1
Clone Name DX246
Protein Name CLEC5A/MDL1
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16094-50
Uniprot ID Q9NY25
Uniprot link Q9NY25
Raw Antigen Sequence MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms C-type lectin superfamily member 5, C-type lectin domain family 5 member A, CLEC5A, MDL-1, CLECSF5, MDL1, Myeloid DAP12-associating lectin 1
Reference ARO-A16094
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CLEC5A/MDL1
Clone Name DX246
Protein Name CLEC5A/MDL1
Target species Anti-Human Monoclonal Antibody

Human CLEC5A/MDL1 Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CLEC5A/MDL1 Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products