Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-CD85f/LILRA5 Polyclonal Antibody

  • PTX20634-50
  • Validated WB

Original price was: €144.00.Current price is: €118.00.

50ug 18% OFF + 118 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-CD85f/LILRA5 Polyclonal Antibody

Product name PTX20634-100
Uniprot ID A6NI73
Raw Antigen Sequence GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-LIR-9, CD85f, LILRA5, ILT11, LILRB7, LIR9, Leukocyte immunoglobulin-like receptor subfamily A member 5, CD85 antigen-like family member F, Immunoglobulin-like transcript 11, ILT-11, Leukocyte immunoglobulin-like receptor 9
Isotype IgG
Clonality Polyclonal Antibody
Protein Name CD85f/LILRA5
Format Liquid
Product name PTX20634-1MG
Uniprot ID A6NI73
Raw Antigen Sequence GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-LIR-9, CD85f, LILRA5, ILT11, LILRB7, LIR9, Leukocyte immunoglobulin-like receptor subfamily A member 5, CD85 antigen-like family member F, Immunoglobulin-like transcript 11, ILT-11, Leukocyte immunoglobulin-like receptor 9
Isotype IgG
Clonality Polyclonal Antibody
Protein Name CD85f/LILRA5
Format Liquid
Product name PTX20634-50
Uniprot ID A6NI73
Raw Antigen Sequence GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-LIR-9, CD85f, LILRA5, ILT11, LILRB7, LIR9, Leukocyte immunoglobulin-like receptor subfamily A member 5, CD85 antigen-like family member F, Immunoglobulin-like transcript 11, ILT-11, Leukocyte immunoglobulin-like receptor 9
Isotype IgG
Clonality Polyclonal Antibody
Protein Name CD85f/LILRA5
Format Liquid

Anti-Human CD85f/LILRA5 Polyclonal Antibody binds to Human CD85f/LILRA5 Recombinant Protein, C-Fc in WB Assay

Anti-Human CD85f/LILRA5 Polyclonal Antibody binds to Human CD85f/LILRA5 Recombinant Protein, C-Fc in WB Assay

Human CD85f/LILRA5 Recombinant Protein, C-Fc(cat. No.ARO-P20635) can bind Anti-Human CD85f/LILRA5 Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Anti-CD85f/LILRA5 Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products