Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD81 Monoclonal Antibody

  • ARO-A15763-50
  • Validated FC WB

Original price was: €271.00.Current price is: €198.00.

50ug 27% OFF + 198 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD81 Monoclonal Antibody

Product name ARO-A15763-100
Uniprot ID P60033
Uniprot link P60033
Raw Antigen Sequence MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms CD81 antigen, TSPAN28, Target of the antiproliferative antibody 1, Tspan-28, Tetraspanin-28, CD81, TAPA1, 26 kDa cell surface protein TAPA-1
Reference ARO-A15763
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD81
Clone Name 005-C01
Protein Name CD81
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15763-1MG
Uniprot ID P60033
Uniprot link P60033
Raw Antigen Sequence MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms CD81 antigen, TSPAN28, Target of the antiproliferative antibody 1, Tspan-28, Tetraspanin-28, CD81, TAPA1, 26 kDa cell surface protein TAPA-1
Reference ARO-A15763
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD81
Clone Name 005-C01
Protein Name CD81
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15763-50
Uniprot ID P60033
Uniprot link P60033
Raw Antigen Sequence MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms CD81 antigen, TSPAN28, Target of the antiproliferative antibody 1, Tspan-28, Tetraspanin-28, CD81, TAPA1, 26 kDa cell surface protein TAPA-1
Reference ARO-A15763
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD81
Clone Name 005-C01
Protein Name CD81
Target species Anti-Human Monoclonal Antibody

Human CD81 Monoclonal Antibody binds to Recombinant Mouse CD81 Protein, N-GST & C-His in WB Assay

Human CD81 Monoclonal Antibody binds to Recombinant Mouse CD81 Protein, N-GST & C-His in WB Assay

Recombinant Mouse CD81 Protein, N-GST & C-His(cat. No.ARO-P10587) can bind Human CD81 Monoclonal Antibody in Western Blot Assay as detected on gel analysis.

Flow Cytometry results for Human CD81 Monoclonal Antibody

Flow Cytometry results for Human CD81 Monoclonal Antibody

Flow-cytometry using anti-human CD81 antibody.Human peripheral blood lymphocytes were stained with an irrelevant antibody (Blue Histogram) or an anti-human CD81 antibody monoclonal antibody (Catalog # ARO-A15763 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-mouse antibody (Catalog # PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

Human CD81 Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD81 Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products