Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD79β/CD79B recombinant protein

  • PX-P6276
  • Validated ELISA
Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P40259
Molecular weight:
24.04 kDa

€329.00

100ug + 329 loyalty points
His Asn37–Pro226
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD79β/CD79B recombinant protein

Product name Human CD79β/CD79B recombinant protein
Uniprot ID P40259
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence NPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHP
Molecular weight 24.04 kDa
Protein delivered with Tag? N-Terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn37-Pro226
Aliases /Synonyms B-cell-specific glycoprotein B29, CD79B, B-cell antigen receptor complex-associated protein beta chain, Ig-beta, B29, Immunoglobulin-associated B29 protein, IGB, CD79b
Reference PX-P6276
Note For research use only
Molecular Constructor
His Asn37–Pro226

Polatuzumab Biosimilar - Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb binds to Human CD79β/CD79B recombinant protein in indirect ELISA Assay

Polatuzumab Biosimilar - Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb binds to Human CD79β/CD79B recombinant protein in indirect ELISA Assay

Immobilized Human CD79β/CD79B recombinant protein (cat. No.PX-P6276) at 0.5µg/mL (100µL/well) can bind to Polatuzumab Biosimilar - Anti-CD79B(CD79b, B29, IGB, Ig-beta) mAb (cat. No.PX-TA1317) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Human CD79β/CD79B recombinant protein

There are no reviews yet.

Be the first to review “Human CD79β/CD79B recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products