Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD79β/CD79B Monoclonal Antibody

  • ARO-A15756-50
  • Validated FC

Original price was: €307.00.Current price is: €231.00.

50ug 25% OFF + 231 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD79β/CD79B Monoclonal Antibody

Product name ARO-A15756-100
Uniprot ID P40259
Uniprot link P40259
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms B-cell-specific glycoprotein B29, CD79B, B-cell antigen receptor complex-associated protein beta chain, Ig-beta, B29, Immunoglobulin-associated B29 protein, IGB, CD79b
Reference ARO-A15756
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD79β/CD79B
Clone Name SAA0036
Protein Name CD79β/CD79B
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15756-1MG
Uniprot ID P40259
Uniprot link P40259
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms B-cell-specific glycoprotein B29, CD79B, B-cell antigen receptor complex-associated protein beta chain, Ig-beta, B29, Immunoglobulin-associated B29 protein, IGB, CD79b
Reference ARO-A15756
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD79β/CD79B
Clone Name SAA0036
Protein Name CD79β/CD79B
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15756-50
Uniprot ID P40259
Uniprot link P40259
Raw Antigen Sequence MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms B-cell-specific glycoprotein B29, CD79B, B-cell antigen receptor complex-associated protein beta chain, Ig-beta, B29, Immunoglobulin-associated B29 protein, IGB, CD79b
Reference ARO-A15756
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD79β/CD79B
Clone Name SAA0036
Protein Name CD79β/CD79B
Target species Anti-Human Monoclonal Antibody

Flow Cytometry results for Human CD79β/CD79B Monoclonal Antibody

Flow Cytometry results for Human CD79β/CD79B Monoclonal Antibody

Flow-cytometry using anti-human CD79β antibody.Human peripheral blood lymphocytes were stained with an irrelevant antibody (Blue Histogram) or an anti-human CD79β antibody monoclonal antibody (Catalog # ARO-A15756 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-mouse antibody (Catalog # PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Human CD79β/CD79B Monoclonal Antibody

Flow Cytometry results for Human CD79β/CD79B Monoclonal Antibody

Flow-cytometry using anti-human CD79β antibody.Daudi cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human CD79β antibody monoclonal antibody (Catalog # ARO-A15756 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-mouse antibody (Catalog # PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

Human CD79β/CD79B Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD79β/CD79B Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products