Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD300f-CD300LF recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q8TDQ1
Molecular weight:
18.60 kDa

420.00

100ug + 420 loyalty points
Thr20–Leu155 His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD300f-CD300LF recombinant protein

Product name Human CD300f-CD300LF recombinant protein
Uniprot ID Q8TDQ1
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKL
Molecular weight 18.60 kDa
Protein delivered with Tag? C-Terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Thr20-Leu155
Aliases /Synonyms CMRF35-like molecule 1, CLM-1, CD300 antigen-like family member F, Immune receptor expressed on myeloid cells 1, IREM-1, Immunoglobulin superfamily member 13, IgSF13, NK inhibitory receptor, CD300f, CD300LF, CD300F, CLM1, IGSF13, IREM1, NKIR, UNQ3105/PRO10111
Reference PX-P6243
Note For research use only
Molecular Constructor
Thr20–Leu155 His

Human CD300f-CD300LF recombinant protein

There are no reviews yet.

Be the first to review “Human CD300f-CD300LF recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products