Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human CD28 recombinant protein
| size | 10ug, 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Human CD28 recombinant protein |
|---|---|
| Uniprot ID | P10747 |
| Uniprot link | http://www.uniprot.org/uniprot/P10747 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK |
| Molecular weight | 42.63kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 70% |
| Buffer | PBS, pH 7.5 |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Applications | ELISA,WB |
| Fragment Type | Partial |
| Aliases /Synonyms | CD28, T-cell-specific surface glycoprotein CD28, Tp44, T-Cell-Specific Surface Glycoprotein, MGC138290 |
| Reference | PX-P4044 |
| Note | For research use only |
Description of Human CD28 recombinant protein
General Information about Human CD28 recombinant protein
CD28 (Cluster of differentiation 28) is a disulfide-linked glycoprotein which belongs to the immunoglobulin (Ig) superfamily. It consists of a single Ig V-like extracellular domain, transmembrane domain and intracellular domain in the structure. composition. Mouse CD28 is structurally expressed on the surface of all parietal cells and is expressed by developing thymocytes into disulfide-bound homodimers or monomers. CD28 can bind to B7-1 and B7-2 ligands and together play an important role in T and B lymphocyte response. Members of the B7 / CD28 family can enhance or antagonize T cell receptor signal transduction and tolerance of peripheral cells according to central regulation. Thus, CD28 is involved in the activation of T cells, the induction of cell proliferation, the production of cytokines and the acceleration of T cell survival.
Related products
Biosimilar
Lulizumab Biosimilar – Anti-CD28 mAb – Research Grade
PX-TA1354 400€
Biosimilar
Tomaralimab Biosimilar – Anti-TLR2, CD282 mAb – Research Grade
PX-TA1453 400€
Biosimilar
Anti-CD28 Biosimilar – Anti-CD28(Tp44) mAb – Research Grade
PX-TA1625 200€
Biosimilar
Theralizumab Biosimilar – Anti-CD28 mAb – Research Grade
PX-TA1927 200€
Ligand
CD80 Recombinant Protein
PX-P4090 420€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.