Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD234/ACKR1 Monoclonal Antibody

Original price was: €310.00.Current price is: €231.00.

50ug 25% OFF + 231 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD234/ACKR1 Monoclonal Antibody

Product name ARO-A15980-100
Uniprot ID Q16570
Uniprot link Q16570
Raw Antigen Sequence MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms Fy glycoprotein, Plasmodium vivax receptor, GpFy, CD234, Atypical chemokine receptor 1, Duffy antigen/chemokine receptor, FY, Glycoprotein D, GPD, ACKR1, DARC
Reference ARO-A15980
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD234/ACKR1
Clone Name 2C3
Protein Name CD234/ACKR1
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15980-1MG
Uniprot ID Q16570
Uniprot link Q16570
Raw Antigen Sequence MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms Fy glycoprotein, Plasmodium vivax receptor, GpFy, CD234, Atypical chemokine receptor 1, Duffy antigen/chemokine receptor, FY, Glycoprotein D, GPD, ACKR1, DARC
Reference ARO-A15980
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD234/ACKR1
Clone Name 2C3
Protein Name CD234/ACKR1
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15980-50
Uniprot ID Q16570
Uniprot link Q16570
Raw Antigen Sequence MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms Fy glycoprotein, Plasmodium vivax receptor, GpFy, CD234, Atypical chemokine receptor 1, Duffy antigen/chemokine receptor, FY, Glycoprotein D, GPD, ACKR1, DARC
Reference ARO-A15980
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD234/ACKR1
Clone Name 2C3
Protein Name CD234/ACKR1
Target species Anti-Human Monoclonal Antibody

SDS-PAGE for Human CD234/ACKR1 Monoclonal Antibody

SDS-PAGE for Human CD234/ACKR1 Monoclonal Antibody

Human CD234/ACKR1 Monoclonal Antibody, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Human CD234/ACKR1 Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD234/ACKR1 Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products